• DRAMP ID

    • DRAMP18496
    • Peptide Name

    • rNZ2114
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • KRGFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY
    • Sequence Length

    • 42
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • [Ref.23624708]Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureusMSSA MIC=0.028 μM;MRSA MIC=0.90μM
    • Hemolytic Activity

      • [Ref.23624708]<0.1% hemolysis upto 128μg/ml against human red blood cells.
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18496 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP18496.
    • Formula

    • C203H304N62O56S6
    • Absent Amino Acids

    • MQT
    • Common Amino Acids

    • G
    • Mass

    • 4701.39
    • PI

    • 9.04
    • Basic Residues

    • 10
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +7
    • Boman Index

    • -8127
    • Hydrophobicity

    • -0.841
    • Aliphatic Index

    • 27.86
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 10345
    • Absorbance 280nm

    • 252.32
    • Polar Residues

    • 21

DRAMP18496

DRAMP18496 chydropathy plot
    • Function

    • Antibacterial activity against Gram-positive bacteria. Weak hemolytic activity.
  • ·Literature 1
    • Title

    • High expression of a plectasin-derived peptide NZ2114 in Pichia pastoris and its pharmacodynamics, postantibiotic and synergy against Staphylococcus aureus.
    • Reference

    • Appl Microbiol Biotechnol
    • Author

    • Yong ZhangDa TengRuoyu MaoXiumin WangDi XiXiaoyuan HuJianhua Wang