General Information

    • DRAMP ID

    • DRAMP20769

    • Peptide Name

    • Naegleriapore A (NP-A; parasite, amoebozoa; protozoa, protists)

    • Source

    • Naegleria fowleri (Brain eating amoeba)

    • Family

    • Not found

    • Gene

    • NP-A

    • Sequence

    • DAECEICKFVIQQVEAFIESNHSQAEIQKELNKLCSSVPSIFTQTCLSIARMVPYIIKKLEEHNSPGQVCQGLHLCKSS

    • Sequence Length

    • 78

    • Protein Existence

    • Protein predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • [Ref.11948186] Gram-positive bacterium: B. subtilis (100% permeabilized bacteria: 158 nM)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20769 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C385H622N104O120S7

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • SEI

    • Mass

    • 8852.22

    • PI

    • 5.86

    • Basic Residues

    • 10

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 26

    • Net Charge

    • +1

    • Boman Index

    • -10281

    • Hydrophobicity

    • -0.091

    • Aliphatic Index

    • 92.53

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 23.91

    • Polar Residues

    • 23

DRAMP20769

DRAMP20769 chydropathy plot

Comments Information

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Pore-forming polypeptides of the pathogenic protozoon Naegleria fowleri.

    • Reference

    • J Biol Chem. 2002 Jun 21;277(25):22353-60.

    • Author

    • Herbst R, Ott C, Jacobs T, Marti T, Marciano-Cabral F, Leippe M.