General Information

    • DRAMP ID

    • DRAMP20770

    • Peptide Name

    • Naegleriapore B (NP-B; parasite, amoebozoa, protozoa, protists)

    • Source

    • Naegleria fowleri (Brain eating amoeba)

    • Family

    • Not found

    • Gene

    • NP-B

    • Sequence

    • SVIGCEICEWLVATAEGFVNKTKPQIEQELLQICAKLGPYEQICDQLVLMELPDIIDQIIAKEPPAIVCSQVKICNGSAMAVAA

    • Sequence Length

    • 84

    • Protein Existence

    • Protein predicted

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20770 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C402H659N99O122S8

    • Absent Amino Acids

    • HR

    • Common Amino Acids

    • I

    • Mass

    • 9087.72

    • PI

    • 4.29

    • Basic Residues

    • 5

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 36

    • Net Charge

    • -6

    • Boman Index

    • -2135

    • Hydrophobicity

    • 0.455

    • Aliphatic Index

    • 118.45

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 88.73

    • Polar Residues

    • 18

DRAMP20770

DRAMP20770 chydropathy plot

Comments Information

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Pore-forming polypeptides of the pathogenic protozoon Naegleria fowleri.

    • Reference

    • J Biol Chem. 2002 Jun 21;277(25):22353-60.

    • Author

    • Herbst R, Ott C, Jacobs T, Marti T, Marciano-Cabral F, Leippe M.