• • DRAMP ID

  • DRAMP20956

• • Peptide Name

  • AL32-P113

• • Source

  • Synthetic construct

• • Family

  • Derived from LL-37 and Hst-5

• • Gene

  • Not found

• • Sequence

  • ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLAKRHHGYKRKFHLEY

• • Sequence Length

  • 46

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Synthetic

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)[C@H](CCC(=O)NCC(=O)N[C@@H](CCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)O)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)[C@H](C)CC)[C@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)O

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • [Ref.29859288] Gram-positive bacteria:

      Target Organism	Activity
      Staphylococcus aureus ATCC 25923	MIC=66.6 ± 28.8 μg/mL

    • Gram-negative bacteria:

      Target Organism	Activity
      Escherichia coli ATCC 25922	MIC=41.6 ± 14.4 μM
      Extended-spectrum beta-lactamase producing Escherichia coli	MIC=41.6 ± 14.4 μg/mL
      New Delhi metallo-bata-lactamase-1 producing Acinetobacter baumannii	MIC=20.8 ± 7.2 μg/mL

    • Fungi:

      Target Organism	Activity
      Candida albicans ATCC 90028	MIC=166.6 ± 57.7 μg/mL

• • Hemolytic Activity

  • • [Ref.29859288] Hemolysis 10.4 ± 2.2% at 500 μg/ml against human red blood cells

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Alpha helix

• • Structure Description

  • The peptide adopts a conformational structure with 81 % alpha helix.

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP20956_predicted_structure.pdb to download.

DRAMP20956

• • Function

  • Antibacterial activity against the Gram-positive and Gram-negative bacteria. Antifungal activity.

• ·Literature 1

• • Title

  • Expression in Escherichia coli of novel recombinant hybrid antimicrobial peptide AL32-P113 with enhanced antimicrobial activity in vitro.

• • Pubmed ID

  • 29859288

• • Reference

  • Gene. 2018 May 30. pii: S0378-1119(18)30617-6.

• • Author

  • Wanmakok M, Orrapin S, Intorasoot A, Intorasoot S.