General Information

    • DRAMP ID

    • DRAMP20956

    • Peptide Name

    • AL32-P113

    • Source

    • Synthetic construct

    • Family

    • Derived from LL-37 and Hst-5

    • Gene

    • Not found

    • Sequence

    • ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLAKRHHGYKRKFHLEY

    • Sequence Length

    • 46

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.29859288] Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (MIC=66.6 ± 28.8 μg/mL);
      • Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=41.6 ± 14.4 μM), Extended-spectrum beta-lactamase producing Escherichia coli (MIC=41.6 ± 14.4 μg/mL), New Delhi metallo-bata-lactamase-1 producing Acinetobacter baumannii (MIC=20.8 ± 7.2 μg/mL);
      • Fungi: Candida albicans ATCC 90028 (MIC=166.6 ± 57.7 μg/mL)

    • Hemolytic Activity

      • [Ref.29859288] Hemolysis 10.4 ± 2.2% at 500 μg/ml against human red blood cells

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • The peptide adopts a conformational structure with 81 % alpha helix.

    • Helical Wheel Diagram

    • DRAMP20956 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20956.

Physicochemical Information

    • Formula

    • C265H421N81O62

    • Absent Amino Acids

    • CMPTW

    • Common Amino Acids

    • K

    • Mass

    • 5733.76

    • PI

    • 10.6

    • Basic Residues

    • 18

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +13

    • Boman Index

    • -14736

    • Hydrophobicity

    • -1.094

    • Aliphatic Index

    • 70

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 66.22

    • Polar Residues

    • 7

DRAMP20956

DRAMP20956 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against the Gram-positive and Gram-negative bacteria. Antifungal activity.

Literature Information

  • ·Literature 1

    • Title

    • Expression in Escherichia coli of novel recombinant hybrid antimicrobial peptide AL32-P113 with enhanced antimicrobial activity in vitro.

    • Reference

    • Gene. 2018 May 30. pii: S0378-1119(18)30617-6.

    • Author

    • Wanmakok M, Orrapin S, Intorasoot A, Intorasoot S.