• DRAMP ID

    • DRAMP29094
    • Peptide Name

    • Turgencin A
    • Source

    • Synoicum turgens
    • Family

    • Not found
    • Gene

    • N/A
    • Sequence

    • GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV
    • Sequence Length

    • 36
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial,Anti-Gram+, Anti-Gram-,Anti-cancer
    • Target Organism

      • [Ref.32751755]Gram-positive bacteria:
        Target OrganismActivity
        Bacillus megaterium(MIC=0.5 µg/mL); Bacillus subtilis(MIC=1.5 µg/mL); Corynebacterium glutamicum(MIC=1.5 µg/mL); Micrococcus luteus(MIC=8.0 µg/mL); Staphylococcus aureus(MIC=23.3 µg/mL);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli(MIC=3.0 µg/mL); Pseudomonas aeruginosa(MIC=5.9 µg/mL);-
      • Fungi: Rhodotorula sp(MIC=23.2 µg/mL);Aurobasidium pollulans(MIC=92.6 µg/mL); Candida albicans(MIC=46.3 µg/mL).
      • [Ref.31940927]Cancer: Human melanoma A2058(IC50=1.4 μM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.31940927]Cytotoxicity: Human fibroblasts MRC-5(IC50=4.8 μM).
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Amidation
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys8 and Cys33, Cys12 and Cys29, Cys17 and Cys26; the 'Met' at position 10 is Methionine sulfoxide.
    • Stereochemistry

    • L
    • Structure

    • Random coil
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29094 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29094.
    • Formula

    • C157H269N45O43S7
    • Absent Amino Acids

    • FHINQRSY
    • Common Amino Acids

    • K
    • Mass

    • 3699.56
    • PI

    • 9.24
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +6
    • Boman Index

    • -2016
    • Hydrophobicity

    • -0.117
    • Aliphatic Index

    • 54.44
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 167.86
    • Polar Residues

    • 13

DRAMP29094

DRAMP29094 chydropathy plot
    • Function

    • Antibacterial activity against Gram-positive bacteria and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Antimicrobial Activity of Small Synthetic Peptides Based on the Marine Peptide Turgencin A: Prediction of Antimicrobial Peptide Sequences in a Natural Peptide and Strategy for Optimization of Potency.
    • Reference

    • Int J Mol Sci.2020 Jul 30;21(15):5460.
    • Author

    • Hansen IKØ, Lövdahl T, Simonovic D, Hansen KØ, Andersen AJC, Devold H, Richard CSM, Andersen JH, Strøm MB, Haug T.
  • ·Literature 2
    • Title

    • Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens.
    • Reference

    • Mar Drugs. 2020 Jan 12;18(1):51.
    • Author

    • Hansen IKØ, Isaksson J, Poth AG, Hansen KØ, Andersen AJC, Richard CSM, Blencke HM, Stensvåg K, Craik DJ, Haug T.