• DRAMP ID

    • DRAMP29095
    • Peptide Name

    • Turgencin B
    • Source

    • Synoicum turgens
    • Family

    • Not found
    • Gene

    • N/A
    • Sequence

    • GIKEMLCNMACAQTVCKKSGGPLCDTCQAACKALG
    • Sequence Length

    • 35
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial,Anti-Gram+, Anti-Gram-,Anti-cancer
    • Target Organism

      • [Ref.31940927]Gram-positive bacteria:
        Target OrganismActivity
        Corynebacterium glutamicum ATCC 13032(MIC=1.6 µM);Bacillus subtilis ATCC 23857(MIC=1.6 µM);Staphylococcus aureus ATCC 9144(MIC>100µM);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli ATCC 25922(MIC=12.5 µM);Pseudomonas aeruginosa ATCC 27853(MIC=25.0 µM);-
      • Cancer: Human melanoma A2058(IC50=4.1 μM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.31940927]Cytotoxicity: Human fibroblasts MRC-5(IC50=7.5 μM).
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Amidation
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys7 and Cys31, Cys11 and Cys27, Cys16 and Cys24; the 'Met' at position 5 and 9 is Methionine sulfoxide.
    • Stereochemistry

    • L
    • Structure

    • Alpha helix,random coil
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29095 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29095.
    • Formula

    • C143H248N42O46S8
    • Absent Amino Acids

    • FHRWY
    • Common Amino Acids

    • C
    • Mass

    • 3548.28
    • PI

    • 8.33
    • Basic Residues

    • 4
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +2
    • Boman Index

    • -1508
    • Hydrophobicity

    • 0.269
    • Aliphatic Index

    • 67.14
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 11.03
    • Polar Residues

    • 14

DRAMP29095

DRAMP29095 chydropathy plot
    • Function

    • Antibacterial activity against Gram-positive bacteria and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Reference

    • Mar Drugs. 2020 Jan 12;18(1):51.
    • Author

    • Hansen IKØ, Isaksson J, Poth AG, Hansen KØ, Andersen AJC, Richard CSM, Blencke HM, Stensvåg K, Craik DJ, Haug T.