• • DRAMP ID

  • DRAMP29151

• • Peptide Name

  • EK1

• • Source

  • Synthetic construct

• • Family

  • Belongs to the betacoronaviruses spike protein family.

• • Gene

  • S

• • Sequence

  • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL

• • Sequence Length

  • 36

• • UniProt Entry

  • Q8BB25

• • Protein Existence

  • Hemology

• • Biological Activity

  • Antimicrobial, Antiviral(SARS-CoV-2)

• • Target Organism

  • • [Ref.35087243]Virus:
    • SARS-CoV-2 Omicron:inhibition of cell-cell fusion in Calu-3 cells(IC50=119.68 nM);inhibition of cell-cell infusion in Caco2 cells(IC50=74.99 nM);inhibition of infection(Pseudovirus)(IC50=309.4 nM);inhibition of infection(Authentic)(IC50=1138 nM);
    • SARS-CoV-2 Delta:inhibition of cell-cell fusion(IC50=131.8 nM);inhibition of infection(Pseudovirus)(IC50=427.55 nM);
    • SARS-CoV-2 D614G:inhibition of cell-cell fusion(IC50=314.6 nM);inhibition of infection(Pseudovirus)(IC50=414.85 nM).
    • [Ref.32231345]Virus:
    • SARS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50=409.3 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=3237 nM);
    • MERS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50=239.5 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=631.8 nM),inhibit the replication of MERS-CoV in VERO-E6 cells(IC50=802.1 nM);
    • HCoV-OC43:ihibition of cell-cell fusion in Huh-7 cells(IC50=787.6 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=1398 nM),inhibit the replication of HCoV-OC43 in RD cells(IC50=1554 nM);
    • HCoV-229E:ihibition of cell-cell fusion in Huh-7 cells(IC50=207.4 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=3963 nM),inhibit the replication of HCoV-229E in Huh-7 cells(IC50=4375 nM);
    • HCoV-NL63:ihibition of cell-cell fusion in Huh-7 cells(IC50=751.0 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=7666 nM),inhibit the replication of HCoV-NL63 in LLC-MK2 cells(IC50=3693 nM);
    • CoV-WIV1:ihibition of cell-cell fusion in Huh-7 cells(IC50=265.7 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=5425 nM);
    • CoV-Rs3367:ihibition of cell-cell fusion in Huh-7 cells(IC50=237.0 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=6014 nM);
    • CoV-SHC014:ihibition of cell-cell fusion in Huh-7 cells(IC50=279.6 nM);
    • SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=286.7-315.0 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=2375.0 nM),inhibit the replication of MERS-CoV in VERO-E6 cells(IC50=2468 nM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP29151.

DRAMP29151

• • Mechanism of action

  • The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection.

• ·Literature 1

• • Title

  • Peptide-based pan-CoV fusion inhibitors maintain high potency against SARS-CoV-2 Omicron variant.

• • Pubmed ID

  • 35087243

• • Reference

  • Cell Res. 2022 Apr;32(4):404-406.

• • Author

  • Xia S, Chan JF, Wang L, Jiao F, Chik KK, Chu H, Lan Q, Xu W, Wang Q, Wang C, Yuen KY, Lu L, Jiang S.

• ·Literature 2

• • Title

  • Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.

• • Pubmed ID

  • 32231345

• • Reference

  • Cell Res. 2020 Apr;30(4):343-355.

• • Author

  • Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.

• ·Literature 3

• • Title

  • A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike.

• • Pubmed ID

  • 30989115

• • Reference

  • Sci Adv. 2019 Apr 10;5(4):eaav4580.

• • Author

  • Xia S, Yan L, Xu W, Agrawal AS, Algaissi A, Tseng CK, Wang Q, Du L, Tan W, Wilson IA, Jiang S, Yang B, Lu L.

• ·Literature 4

• • Title

  • Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein.

• • Pubmed ID

  • 32047258

• • Reference

  • Cell Mol Immunol. 2020 Jul;17(7):765-767.

• • Author

  • Xia S, Zhu Y, Liu M, Lan Q, Xu W, Wu Y, Ying T, Liu S, Shi Z, Jiang S, Lu L.