• DRAMP ID

    • DRAMP29152
    • Peptide Name

    • EK1P
    • Source

    • Synthetic construct
    • Family

    • Belongs to the betacoronaviruses spike protein family.
    • Gene

    • S
    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
    • Sequence Length

    • 36
    • Protein Existence

    • Hemology
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.32231345]Virus:
      • SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=69.2 nM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • PEG4-C(Palm)
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29152 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29152.
    • Formula

    • C196H317N43O64S
    • Absent Amino Acids

    • CGHPRW
    • Common Amino Acids

    • EL
    • Mass

    • 4331.98
    • PI

    • 4.36
    • Basic Residues

    • 5
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 13
    • Net Charge

    • -5
    • Boman Index

    • -6303
    • Hydrophobicity

    • -0.433
    • Aliphatic Index

    • 119.17
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 85.14
    • Polar Residues

    • 6

DRAMP29152

DRAMP29152 chydropathy plot
    • Mechanism of action

    • The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection.
  • ·Literature 1
    • Title

    • Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.
    • Reference

    • Cell Res. 2020 Apr;30(4):343-355.
    • Author

    • Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.