• DRAMP ID

    • DRAMP29157
    • Peptide Name

    • EK1C4
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG
    • Sequence Length

    • 41
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.35087243]Virus:
      • SARS-CoV-2 Omicron:
        Target OrganismActivity
        inhibition of cell-cell fusion in Calu-3 cells(IC50=3.32 nM);inhibition of cell-cell infusion in Caco2 cells(IC50=0.88 nM);inhibition of infection(Pseudovirus)(IC50=8.63 nM);inhibition of infection(Authentic)IC50=85.38 nM
      • SARS-CoV-2 Delta:
        Target OrganismActivity
        inhibition of cell-cell fusion(IC50=4.04 nM);inhibition of infection(Pseudovirus)IC50=9.83 nM
      • SARS-CoV-2 D614G:
        Target OrganismActivity
        inhibition of cell-cell fusion(IC50=2.57 nM);inhibition of infection(Pseudovirus)IC50=5.58 nM
      • [Ref.32231345]Virus:
      • SARS-CoV:
        Target OrganismActivity
        ihibition of cell-cell fusion in Huh-7 cellsIC50=4.3 nM
        inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cellsIC50=11.7 nM
      • MERS-CoV:
        Target OrganismActivity
        ihibition of cell-cell fusion in Huh-7 cellsIC50=2.5 nM
        inhibition of Pseudovirus (PsV) infection in Huh-7 cellsIC50=11.1 nM
        inhibit the replication of MERS-CoV in VERO-E6 cellsIC50=4.2 nM
      • HCoV-OC43: ihibition of cell-cell fusion in Huh-7 cells(IC50=7.7 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=37.7 nM),inhibit the replication of HCoV-OC43 in RD cells(IC50=24.8 nM);
      • HCoV-229E: ihibition of cell-cell fusion in Huh-7 cells(IC50=5.2 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=12.4 nM),inhibit the replication of HCoV-229E in Huh-7 cells(IC50=101.5 nM);
      • HCoV-NL63: ihibition of cell-cell fusion in Huh-7 cells(IC50=21.4 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=76.6 nM),inhibit the replication of HCoV-NL63 in LLC-MK2 cells(IC50=187.6 nM);
      • CoV-WIV1: ihibition of cell-cell fusion in Huh-7 cells(IC50=4.5 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=30.8 nM);
      • CoV-Rs3367: ihibition of cell-cell fusion in Huh-7 cells(IC50=8.1 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=66.9 nM);
      • CoV-SHC014: ihibition of cell-cell fusion in Huh-7 cells(IC50=4.3 nM);
      • SARS-CoV-2:
        Target OrganismActivity
        ihibition of cell-cell fusion in 293T/ACE2 cellsIC50=1.3 nM
        inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cellsIC50=15.8 nM
        inhibit the replication of MERS-CoV in VERO-E6 cellsIC50=2468 nM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.32231345]<10% cytotoxicity against VERO-E6 cells, RD cells, LLC-MK2 cells, Huh-7 cells up to 10000 nM.
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • PEG4-Chol
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C208H336N48O71S
    • Absent Amino Acids

    • CHPRW
    • Common Amino Acids

    • EL
    • Mass

    • 4677.29
    • PI

    • 4.36
    • Basic Residues

    • 5
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 13
    • Net Charge

    • -5
    • Boman Index

    • -6701
    • Hydrophobicity

    • -0.449
    • Aliphatic Index

    • 104.63
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 74.5
    • Polar Residues

    • 11

DRAMP29157

    • Mechanism of action

    • The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection.
  • ·Literature 1
    • Title

    • Peptide-based pan-CoV fusion inhibitors maintain high potency against SARS-CoV-2 Omicron variant.
    • Reference

    • Cell Res. 2022 Apr;32(4):404-406.
    • Author

    • Xia S, Chan JF, Wang L, Jiao F, Chik KK, Chu H, Lan Q, Xu W, Wang Q, Wang C, Yuen KY, Lu L, Jiang S.
  • ·Literature 2
    • Title

    • Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.
    • Reference

    • Cell Res. 2020 Apr;30(4):343-355.
    • Author

    • Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.