• DRAMP ID

    • DRAMP29161
    • Peptide Name

    • EK1-scrambled
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • LKVLLYEEFKLLESLIMEILEYQKDSDIKENAEDTK
    • Sequence Length

    • 36
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.32231345]Virus: SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-OC43,HCoV-229E,HCoV-NL63,CoV-WIV1,CoV-Rs3367,CoV-SHC014(No inhibition on the concentration up to 10 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29161 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29161.
    • Formula

    • C196H317N43O64S
    • Absent Amino Acids

    • CGHPRW
    • Common Amino Acids

    • EL
    • Mass

    • 4331.98
    • PI

    • 4.36
    • Basic Residues

    • 5
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 13
    • Net Charge

    • -5
    • Boman Index

    • -6303
    • Hydrophobicity

    • -0.433
    • Aliphatic Index

    • 119.17
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 85.14
    • Polar Residues

    • 6

DRAMP29161

DRAMP29161 chydropathy plot
    • Mechanism of action

    • The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection.
  • ·Literature 1
    • Title

    • Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.
    • Reference

    • Cell Res. 2020 Apr;30(4):343-355.
    • Author

    • Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.