General Information

    • DRAMP ID

    • DRAMP29163

    • Peptide Name

    • EK1-C16

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

    • Sequence Length

    • 41

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.35336956]Virus:
      • SARS-CoV-2 WT:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.48 μM);
      • SARS-CoV-2 Alpha:inhibition of pseudovirus (PsV) infection(IC50=0.19 μM);
      • SARS-CoV-2 Beta:inhibition of pseudovirus (PsV) infection(IC50=0.43 μM);
      • SARS-CoV-2 Gamma:inhibition of pseudovirus (PsV) infection(IC50=0.26 μM);
      • SARS-CoV-2 Delta:inhibition of pseudovirus (PsV) infection(IC50=0.11 μM);
      • SARS-CoV-2 Omicron:inhibition of pseudovirus (PsV) infection(IC50=0.23 μM);inhibition of authentic infection in Vero-E6-TMPRSS-2 cells(IC50=0.75 μM);
      • SARS-CoV:inhibition of pseudovirus (PsV) infection(IC50=0.17 μM);
      • SARSr-CoV WIV1:inhibition of pseudovirus (PsV) infection(IC50=0.15 μM);
      • SARSr-CoV Rs3367:inhibition of pseudovirus (PsV) infection(IC50=0.3 μM);
      • MERS-CoV:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.10 μM);inhibition of cell-cell fusion(IC50=0.012 μM);
      • HCoV-OC43:inhibition of authentic infection in RD cells(IC50=0.07 μM);inhibition of cell-cell fusion(IC50=0.01 μM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.35336956]showed no significant cytotoxicity against RD cells at the concentration of 5 μM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • PEG4-C16(palmitic acid)

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29163 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29163.

Physicochemical Information

    • Formula

    • C208H336N48O71S

    • Absent Amino Acids

    • CHPRW

    • Common Amino Acids

    • EL

    • Mass

    • 4677.29

    • PI

    • 4.36

    • Basic Residues

    • 5

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 13

    • Net Charge

    • -5

    • Boman Index

    • -6701

    • Hydrophobicity

    • -0.449

    • Aliphatic Index

    • 104.63

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 74.5

    • Polar Residues

    • 11

DRAMP29163

DRAMP29163 chydropathy plot

Comments Information

    • EK1-C16 at 0.31 μM could effectively inhibit authentic SARS-CoV-2 WT infection.

Literature Information

  • ·Literature 1

    • Title

    • A Palmitic Acid-Conjugated, Peptide-Based pan-CoV Fusion Inhibitor Potently Inhibits Infection of SARS-CoV-2 Omicron and Other Variants of Concern.

    • Reference

    • Viruses. 2022 Mar 6;14(3):549.

    • Author

    • Lan Q, Chan JF, Xu W, Wang L, Jiao F, Zhang G, Pu J, Zhou J, Xia S, Lu L, Yuen KY, Jiang S, Wang Q.