• DRAMP ID

    • DRAMP29170
    • Peptide Name

    • EKL3C
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • LDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKWGSGC
    • Sequence Length

    • 40
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.127±0.293 μmol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=1.176±1.230 μmol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.892±0.069 μmol/L),inhibition of cell-cell fusion(IC50=0.045±0.004 μmol/L).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Chol
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29170 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29170.
    • Formula

    • C220H337N47O69S2
    • Absent Amino Acids

    • FHNPQR
    • Common Amino Acids

    • E
    • Mass

    • 4808.49
    • PI

    • 4.57
    • Basic Residues

    • 6
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 11
    • Net Charge

    • -4
    • Boman Index

    • -6130
    • Hydrophobicity

    • -0.678
    • Aliphatic Index

    • 87.75
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 12950
    • Absorbance 280nm

    • 332.05
    • Polar Residues

    • 12

DRAMP29170

DRAMP29170 chydropathy plot
    • The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs.

  • ·Literature 1
    • Title

    • A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.
    • Reference

    • Acta Pharm Sin B. 2021 Aug 2.
    • Author

    • Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.