• DRAMP ID

    • DRAMP29178
    • Peptide Name

    • 8P9R(branched P9R)
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • NGAICWGPCPTAFRQIGNCGRFRVRCCRIR
    • Sequence Length

    • 30
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.33750821]Virus:SARS-CoV-2:inhibition of replication in high salt condition(IC50 = 0.3 μg/ml)
    • Hemolytic Activity

      • [Ref.33750821]no obvious hemolysis was observed when turkey red blood cells were treated at 200 μg/ml.
    • Cytotoxicity

      • [Ref.33750821]Vero-E6 cells:the cytotoxicity indicated that TC50 of 8P9R was higher than 200 μg/ml.
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Branched
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29178 helical wheel diagram
  • 6M56-> 
    • Predicted Structure

    • There is no predicted structure for DRAMP29178.
    • Formula

    • C144H232N52O35S5
    • Absent Amino Acids

    • DEHKLMSY
    • Common Amino Acids

    • R
    • Mass

    • 3412.05
    • PI

    • 10.46
    • Basic Residues

    • 6
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +6
    • Boman Index

    • -7004
    • Hydrophobicity

    • -0.15
    • Aliphatic Index

    • 55.33
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5750
    • Absorbance 280nm

    • 198.28
    • Polar Residues

    • 12

DRAMP29178

DRAMP29178 chydropathy plot
    • Mechanism of action

    • Have dual-antiviral mechanisms of cross-linking viruses to stop viral entry (mediated by TMPRSS2 for SARS-CoV-2) and of reducing endosomal acidification to inhibit viral entry through endocytic pathway.
  • ·Literature 1
    • Title

    • Cross-linking peptide and repurposed drugs inhibit both entry pathways of SARS-CoV-2.
    • Reference

    • Nat Commun. 2021 Mar 9;12(1):1517.
    • Author

    • Zhao H, To KKW, Lam H, Zhou X, Chan JF, Peng Z, Lee ACY, Cai J, Chan WM, Ip JD, Chan CC, Yeung ML, Zhang AJ, Chu AWH, Jiang S, Yuen KY.