• DRAMP ID

    • DRAMP29191
    • Peptide Name

    • LCB3
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • NDDELHMLMTDLVYEALHFAKDEEIKKRVFQLFELADKAYKNNDRQKLEKVVEELKELLERLLS
    • Sequence Length

    • 64
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.32907861]Virus: SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=48.1 pM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29191 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29191.
    • Formula

    • C346H556N90O106S2
    • Absent Amino Acids

    • CGPW
    • Common Amino Acids

    • L
    • Mass

    • 7736.88
    • PI

    • 4.94
    • Basic Residues

    • 13
    • Acidic Residues

    • 16
    • Hydrophobic Residues

    • 24
    • Net Charge

    • -3
    • Boman Index

    • -15515
    • Hydrophobicity

    • -0.663
    • Aliphatic Index

    • 103.59
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 47.3
    • Polar Residues

    • 7

DRAMP29191

DRAMP29191 chydropathy plot
    • Mechanism of action

    • The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding.
  • ·Literature 1
    • Title

    • De novo design of picomolar SARS-CoV-2 miniprotein inhibitors.
    • Reference

    • Science. 2020 Oct 23;370(6515):426-431.
    • Author

    • Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D.