General Information

    • DRAMP ID

    • DRAMP29205

    • Peptide Name

    • Covid_extented_1

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RFDGKGLGIYQYMEEIEHAASRFAYFFYQHLA

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.34624194]Virus:
      • SARS-CoV-2:inhibition of infection in Vero cells(IC50=5.76 ± 1.65 μM);
      • SARS-CoV-2 variants B.1.1.7:inhibition of infection in Vero cells(IC50=5.57 ± 4.04 μM);
      • SARS-CoV-2 variants B.1.351:inhibition of infection in Vero cells(IC50=7.37 ± 1.80 μM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Acylation

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • D

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29205 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29205.

Physicochemical Information

    • Formula

    • C181H253N45O48S

    • Absent Amino Acids

    • CNPTVW

    • Common Amino Acids

    • AFY

    • Mass

    • 3859.33

    • PI

    • 6.03

    • Basic Residues

    • 5

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +1

    • Boman Index

    • -4489

    • Hydrophobicity

    • -0.331

    • Aliphatic Index

    • 61.25

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5960

    • Absorbance 280nm

    • 192.26

    • Polar Residues

    • 8

DRAMP29205

DRAMP29205 chydropathy plot

Comments Information

    • Mechanism of action

    • The peptide acts as an inhibitor of the RBD–ACE2 interaction

Literature Information

  • ·Literature 1

    • Title

    • Computational Design of Potent D-Peptide Inhibitors of SARS-CoV-2.

    • Reference

    • J Med Chem. 2021 Oct 28;64(20):14955-14967.

    • Author

    • Valiente PA, Wen H, Nim S, Lee J, Kim HJ, Kim J, Perez-Riba A, Paudel YP, Hwang I, Kim KD, Kim S, Kim PM.