• DRAMP ID

    • DRAMP29211
    • Peptide Name

    • EK1P4HC
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG
    • Sequence Length

    • 41
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.34769299]Virus:
      • SARS-CoV-2: inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.8 μM);
      • SARS-CoV-2 B.1.1.7 (Alpha): inhibition of Pseudoviruse infection in Caco2 cells(IC50=2.28 μM);
      • SARS-CoV-2 B.1.351 (Beta): inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.62 μM);
      • SARS-CoV-2 P.1 (Gamma): inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.48 μM);
      • SARS-CoV-2 B.1.617.2 (Delta): inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.11 μM);
      • HCoV-229E(Authentic): inhibition of infection in Caco2 cells(IC50=0.48 μM);
      • HCoV-OC43(Authentic): inhibition of infection in Caco2 cells(IC50=0.41 μM);
      • SARS-CoV: inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.35 μM);
      • MERS-CoV: inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.10 μM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 μM.
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • PEG4-25-HC
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29211 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29211.
    • Formula

    • C208H336N48O71S
    • Absent Amino Acids

    • CHPRW
    • Common Amino Acids

    • EL
    • Mass

    • 4677.29
    • PI

    • 4.36
    • Basic Residues

    • 5
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 13
    • Net Charge

    • -5
    • Boman Index

    • -6701
    • Hydrophobicity

    • -0.449
    • Aliphatic Index

    • 104.63
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 74.5
    • Polar Residues

    • 11

DRAMP29211

DRAMP29211 chydropathy plot
    • The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.

  • ·Literature 1
    • Title

    • 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.
    • Reference

    • Int J Mol Sci. 2021 Nov 1;22(21):11869.
    • Author

    • Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.