• DRAMP ID

    • DRAMP29231
    • Peptide Name

    • EK1V2
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
    • Sequence Length

    • 36
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.34344868]Virus:
      • SARS-CoV-2: inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.9±0.2 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=87.2±8.3 nM);
      • SARS-CoV-2 D614G: inhibition of S protein-mediated cell-cell fusion(IC50=0.5±0.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=106.5±5.4 nM);
      • SARS-CoV: inhibition of pseudovirus infection in Huh-7 cells(IC50=252±5.6 nM);
      • MERS-CoV: inhibition of pseudovirus infection in Huh-7 cells(IC50=1.1±0.3 nM);
      • HCoV-NL63: inhibition of pseudovirus infection in Huh-7 cells(IC50=59.4±13.1 nM);
      • HCoV-229E: inhibition of pseudovirus infection in Huh-7 cells(IC50=503.3±20.9 nM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • PEG8-K(Chol)
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • 68% α-helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 μM and incubated at 37°C
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP29231 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP29231.
    • Formula

    • C196H317N43O64S
    • Absent Amino Acids

    • CGHPRW
    • Common Amino Acids

    • EL
    • Mass

    • 4331.98
    • PI

    • 4.36
    • Basic Residues

    • 5
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 13
    • Net Charge

    • -5
    • Boman Index

    • -6303
    • Hydrophobicity

    • -0.433
    • Aliphatic Index

    • 119.17
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 85.14
    • Polar Residues

    • 6

DRAMP29231

DRAMP29231 chydropathy plot
    • The peptide is a fusion inhibitor against SARS-CoV-2.

  • ·Literature 1
    • Title

    • SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses.
    • Reference

    • Signal Transduct Target Ther. 2021 Aug 3;6(1):294.
    • Author

    • Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y.