General Information

    • DRAMP ID

    • DRAMP29949

    • Peptide Name

    • BmKDfsin3

    • Source

    • Mesobuthus martensii Karsch

    • Family

    • Flaviviridae

    • Gene

    • Not found

    • Sequence

    • GFGCPFNQGKCHRHCRSIRRRGGYCDGFLKQRCVCYRK

    • Sequence Length

    • 38

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • [Ref.31963532]Hepatitis C virus (HCV): inhibition of viral replication in Huh7.5.1 cells(IC50=3.35±1.1 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.31963532]Human hepatocellular carcinoma Huh-7.5.1 cells: CC50=60.63±1.36 µM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys25, Cys11 and Cys33, Cys15 and Cys35.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP29949 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP29949.

Physicochemical Information

    • Formula

    • C190H299N69O47S6

    • Absent Amino Acids

    • AEMTW

    • Common Amino Acids

    • R

    • Mass

    • 4494.26

    • PI

    • 10

    • Basic Residues

    • 12

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +11

    • Boman Index

    • -12439

    • Hydrophobicity

    • -0.924

    • Aliphatic Index

    • 28.16

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 90.68

    • Polar Residues

    • 16

DRAMP29949

DRAMP29949 chydropathy plot

Comments Information

    • Mechanism

    • BmKDfsin3 is revealed to enter into cells. Using an upstream MyD88 dimerization inhibitor ST2345 or kinase IRAK-1/4 inhibitor I, the inhibition of p38 activation represses HCV replication in vitro.

Literature Information

  • ·Literature 1

    • Title

    • Inhibitory Activity of a Scorpion Defensin BmKDfsin3 against Hepatitis C Virus.

    • Reference

    • Antibiotics (Basel). 2020 Jan 17;9(1):33.

    • Author

    • Cheng Y, Sun F, Li S, Gao M, Wang L, Sarhan M, Abdel-Rahman MA, Li W, Kwok HF, Wu Y, Cao Z.