• DRAMP ID

    • DRAMP30386
    • Peptide Name

    • MT-WQ-IDL-scrambled
    • Source

    • Synthetic construct
    • Family

    • Retroviridae
    • Gene

    • Not found
    • Sequence

    • EEQKTQLKNKIEIDWTKMELEQDWSKIYKEI
    • Sequence Length

    • 31
    • Protein Existence

    • Not found
    • SMILES

    • CC[C@@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CC[C@H](NC(=O)[C@H](CCC(=O)N[C@@H](CCC(N)=O)C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCC(=O)N[C@@H](CCC(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O)[C@H](C)CC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)[C@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O)C(=O)N[C@@H](CC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)O)[C@H](C)CC)C(=O)O
    • Biological Activity

    • Antimicrobial, Antiviral
    • Target Organism

      • [Ref.27795416]HIV-1 IIIB:
        Target OrganismActivity
        inhibition of peptide against cell-cell fusion between H9/HIV-1 IIIB cells and MT-2 cellsIC50>500 nM
      • HIV-1 Bal:
        Target OrganismActivity
        inhibition of virus infection in MT-2 cellsIC50>500 nM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • membrane
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C176H279N43O56S
    • Absent Amino Acids

    • ACFGHPRV
    • Common Amino Acids

    • EK
    • Mass

    • 3925.47
    • PI

    • 4.86
    • Basic Residues

    • 6
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 8
    • Net Charge

    • -2
    • Boman Index

    • -8701
    • Hydrophobicity

    • -1.394
    • Aliphatic Index

    • 75.48
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12490
    • Absorbance 280nm

    • 416.33
    • Polar Residues

    • 5

DRAMP30386

    • Mechanism

    • The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.
  • ·Literature 1
    • Title

    • Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.
    • Reference

    • J Virol. 2016 Dec 16;91(1):e01445-16.
    • Author

    • Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L.