• DRAMP ID

    • DRAMP00002
    • Peptide Name

    • Entianin (Bacteriocin)
    • Source

    • Bacillus subtilis subsp. spizizenii DSM 15029(T) (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • Not found
    • Sequence

    • WKSESVCTPGCVTGLLQTCFLQTITCNCKISK
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

      • [Ref.21239550] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC = 4-8 μg/ml),Staphylococcus aureus ATCC 43300 (MRSA)(MIC = 8 μg/ml), Enterococcus faecalis ATCC 29212(MIC = 16μg/ml), Micrococcus luteus ATCC 9341(MIC = 4-8μg/ml), Enterococcus faecalis ATCC 51299 (VRE) (MIC = 8-16 μg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Succinylation
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • There are two dehydroalanines (S5; S31),one dehydrobutyrine (T18),one lanthionine (S3-C7) and four β-methyllanthionines (T8-C11; T13-C19; T23-C26; T25-C28).
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00002 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00002.
    • Formula

    • C150H247N39O46S5
    • Absent Amino Acids

    • ADHMRY
    • Common Amino Acids

    • CT
    • Mass

    • 3493.14
    • PI

    • 8.42
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +2
    • Boman Index

    • -17.96
    • Hydrophobicity

    • 0.288
    • Aliphatic Index

    • 79.06
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5750
    • Absorbance 280nm

    • 185.48
    • Polar Residues

    • 16

DRAMP00002

DRAMP00002 chydropathy plot
    • Function

    • Entianin is very active against several Gram-positive pathogens, such as Staphylococcus aureus and Enterococcus faecalis.
  • ·Literature 1
    • Title

    • Entianin, a Novel Subtilin-Like Lantibiotic from Bacillus subtilis DSM 15029T with High Antimicrobial Activity.
    • Reference

    • Appl Environ Microbiol. 2011 Mar;77(5):1698-1707.
    • Author

    • Fuchs SW, Jaskolla TW, Bochmann S, Kötter P, Wichelhaus T, Karas M, Stein T, Entian KD.