• DRAMP ID

    • DRAMP00002
    • Peptide Name

    • Entianin (Bacteriocin)
    • Source

    • Bacillus subtilis subsp. spizizenii DSM 15029(T) (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • Unknow
    • Sequence

    • WKSESVCTPGCVTGLLQTCFLQTITCNCKISK
    • Sequence Length

    • 32
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00002 helical wheel diagram
    • Formula

    • C150H247N39O46S5
    • Absent Amino Acids

    • ADHMRY
    • Common Amino Acids

    • CT
    • Mass

    • 4046.28
    • PI

    • 8.21
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -17.96
    • Hydrophobicity

    • 28.75
    • Aliphatic Index

    • 79.06
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5750
    • Absorbance 280nm

    • 185.48
    • Polar Residues

    • 16

DRAMP00002

DRAMP00002 chydropathy plot
    • Function

    • Entianin is very active against several Gram-positive pathogens, such as Staphylococcus aureus and Enterococcus faecalis.
  • Literature 1
    • Reference

    • Appl Environ Microbiol. 2011 Mar;77(5):1698-1707.
    • Author

    • Fuchs SW, Jaskolla TW, Bochmann S, K├Âtter P, Wichelhaus T, Karas M, Stein T, Entian KD.
    • Title

    • Entianin, a Novel Subtilin-Like Lantibiotic from Bacillus subtilis DSM 15029T with High Antimicrobial Activity.