General Information

    • DRAMP ID

    • DRAMP00002

    • Peptide Name

    • Entianin (Bacteriocin)

    • Source

    • Bacillus subtilis subsp. spizizenii DSM 15029(T) (Gram-positive bacteria)

    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)

    • Gene

    • Not found

    • Sequence

    • WKSESVCTPGCVTGLLQTCFLQTITCNCKISK

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

      • [Ref.21239550] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC = 4-8 μg/ml),Staphylococcus aureus ATCC 43300 (MRSA)(MIC = 8 μg/ml), Enterococcus faecalis ATCC 29212(MIC = 16μg/ml), Micrococcus luteus ATCC 9341(MIC = 4-8μg/ml), Enterococcus faecalis ATCC 51299 (VRE) (MIC = 8-16 μg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Succinylation

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are two dehydroalanines (S5; S31),one dehydrobutyrine (T18),one lanthionine (S3-C7) and four β-methyllanthionines (T8-C11; T13-C19; T23-C26; T25-C28).

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00002 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00002.

Physicochemical Information

    • Formula

    • C150H247N39O46S5

    • Absent Amino Acids

    • ADHMRY

    • Common Amino Acids

    • CT

    • Mass

    • 3493.14

    • PI

    • 8.42

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +2

    • Boman Index

    • -17.96

    • Hydrophobicity

    • 0.288

    • Aliphatic Index

    • 79.06

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 185.48

    • Polar Residues

    • 16

DRAMP00002

DRAMP00002 chydropathy plot

Comments Information

    • Function

    • Entianin is very active against several Gram-positive pathogens, such as Staphylococcus aureus and Enterococcus faecalis.

Literature Information

  • ·Literature 1

    • Title

    • Entianin, a Novel Subtilin-Like Lantibiotic from Bacillus subtilis DSM 15029T with High Antimicrobial Activity.

    • Reference

    • Appl Environ Microbiol. 2011 Mar;77(5):1698-1707.

    • Author

    • Fuchs SW, Jaskolla TW, Bochmann S, Kötter P, Wichelhaus T, Karas M, Stein T, Entian KD.