• DRAMP ID

    • DRAMP00004
    • Peptide Name

    • Lantibiotic (Bacteriocin)
    • Source

    • Streptococcus pyogenes serotype M28 (strain MGAS6180) (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • srtA
    • Sequence

    • MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK
    • Sequence Length

    • 46
    • Evidence code

    • Predicted
    • Biological Activity

    • Antibacterial
    • Target Organism

      • No MICs found on DRAMP database
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00004 helical wheel diagram
    • Formula

    • C231H367N59O70S4
    • Absent Amino Acids

    • EHQ
    • Common Amino Acids

    • T
    • Mass

    • 6021.89
    • PI

    • 8.9
    • Basic Residues

    • 7
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -75.77
    • Hydrophobicity

    • -39.13
    • Aliphatic Index

    • 63.48
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 191.22
    • Polar Residues

    • 20
browser doesn't support html5

Amino Acid Distribution

DRAMP00004 chydropathy plot
    • Function

    • Active on certain Gram-positive bacteria.
  • Literature 1
    • Reference

    • J Infect Dis. 2005 Sep 1;192(5):760-770.
    • Author

    • Green NM, Zhang S, Porcella SF, Nagiec MJ, Barbian KD, Beres SB, LeFebvre RB, Musser JM.
    • Title

    • Genome sequence of a serotype M28 strain of group a streptococcus: potential new insights into puerperal sepsis and bacterial disease specificity.