General Information

    • DRAMP ID

    • DRAMP00004

    • Peptide Name

    • Lantibiotic (Bacteriocin)

    • Source

    • Streptococcus pyogenes serotype M28 (strain MGAS6180) (Gram-positive bacteria)

    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)

    • Gene

    • srtA

    • Sequence

    • MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK

    • Sequence Length

    • 46

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00004 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00004.

Physicochemical Information

    • Formula

    • C231H367N59O70S4

    • Absent Amino Acids

    • EHQ

    • Common Amino Acids

    • T

    • Mass

    • 5219.05

    • PI

    • 8.93

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -75.77

    • Hydrophobicity

    • -0.391

    • Aliphatic Index

    • 63.48

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8605

    • Absorbance 280nm

    • 191.22

    • Polar Residues

    • 20

DRAMP00004

DRAMP00004 chydropathy plot

Comments Information

    • Function

    • Active on certain Gram-positive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Genome sequence of a serotype M28 strain of group a streptococcus: potential new insights into puerperal sepsis and bacterial disease specificity.

    • Reference

    • J Infect Dis. 2005 Sep 1;192(5):760-770.

    • Author

    • Green NM, Zhang S, Porcella SF, Nagiec MJ, Barbian KD, Beres SB, LeFebvre RB, Musser JM.