General Information

    • DRAMP ID

    • DRAMP00005

    • Peptide Name

    • Epicidin 280 (Bacteriocin)

    • Source

    • Staphylococcus epidermidis BN 280 (Gram-positive bacteria)

    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)

    • Gene

    • eciA

    • Sequence

    • SLGPAIKATRQVCPKATRFVTVSCKKSDCQ

    • Sequence Length

    • 30

    • Evidence code

    • Protein level

Activity Information

    • Biological Activity

    • Antibacterial, Anti-Gram+, Antimicrobial

    • Target Organism

      • Gram-positive bacteria: Staphylococcus simulans 22 (MIC=0.304 μg/ml), Staphylococcus epidermidis 5 (MIC=3.85 μg/ml), Micrococcus luteus ATCC4698 (MIC=9.7 μg/ml), Staphylococcus carnosus TM300 (MIC=0.175 μg/ml).

    • Hemolytic Activity

      • N/A

    • Cytotoxicity

    • Binding Target

    • N/A

Structure Information

    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A

    • Structure Description

    • N/A
    • DRAMP00005 helical wheel diagram

Physical Information

    • Formula

    • C137H236N42O41S3

    • Absent Amino Acids

    • EHMNWY

    • Common Amino Acids

    • K

    • Mass

    • 3741.27

    • PI

    • 10.35

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Boman Index

    • -54.6

    • Hydrophobicity

    • -22

    • Aliphatic Index

    • 65

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 4.31

    • Polar Residues

    • 10

DRAMP00005

DRAMP00005 chydropathy plot

Comments Information

    • Function

    • Lanthionine-containing peptide antibiotic (lantibiotic) Transiently and partially depolarizes the transmembrane electrical potential and pH gradient of susceptible cells, inhibits the uptake of amino acids and depletes the intracellular ATP pool.

    • PTM

    • Maturation of lantibiotics involves the enzymic conversion of Thr, and Ser into dehydrated AA and the formation of thioether bonds with cysteine. This is followed by membrane translocation and cleavage of the modified precursor.

Literature Information

  • Literature 1

    • Reference

    • Appl Environ Microbiol. 1998 Sep;64(9):3140-3146.

    • Author

    • Heidrich C, Pag U, Josten M, Metzger J, Jack RW, Bierbaum G, Jung G, Sahl HG.

    • Title

    • Isolation, characterization, and heterologous expression of the novel lantibiotic epicidin 280 and analysis of its biosynthetic gene cluster.