• DRAMP ID

    • DRAMP00008
    • Peptide Name

    • Lacticin 3147 A1 (LtnA1; Bacteriocin; Preclinical)
    • Source

    • Lactococcus lactis subsp. lactis (Streptococcus lactis) (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • ltnA1
    • Sequence

    • CSTNTFSLSDYWGNNGAWCTLTHECMAWCK
    • Sequence Length

    • 30
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Enterococcus, Lactobacillus, Lactococcus, Leuconostoc.
    • Binding Traget

    • Lipid II
    • Structure

    • Alpha helix
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00008 helical wheel diagram
    • Formula

    • C148H209N39O46S5
    • Absent Amino Acids

    • IPQRV
    • Common Amino Acids

    • CT
    • Mass

    • 3948.28
    • PI

    • 5.44
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 8
    • Boman Index

    • -33.5
    • Hydrophobicity

    • -29
    • Aliphatic Index

    • 32.67
    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18240
    • Absorbance 280nm

    • 628.97
    • Polar Residues

    • 17
browser doesn't support html5

Amino Acid Distribution

DRAMP00008 chydropathy plot
    • Function

    • Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. When present individually lacticin 3147 A1 exhibits strong activity towards L.lactis strain AM2, weak activity towards L.lactis strain HP and no activity towards L.lactis strain IFPL359, but when combined with lacticin 3147 A2 it displays strong activity towards all three strains.
    • PTM

    • There are two 2,3-dehydrobutyrines (T3; T5), one 2,3-didehydroalanine (S7), two Lanthionines (C1-S2; S9-C19) and two Beta-methyllanthionines (T20-C25; T22-C29).
  • Literature 1
    • Reference

    • J Appl Microbiol. 2000 Aug;89(2):249-260.
    • Author

    • Mart­nez-Cuesta MC, Buist G, Kok J, Hauge HH, Nissen-Meyer J, Pel¡ez C, Requena T.
    • Title

    • Biological and molecular characterization of a two-peptide lantibiotic produced by Lactococcus lactis IFPL105.
  • Literature 2
    • Reference

    • Biochemistry. 2004 Mar 23;43(11):3049-3056.
    • Author

    • Martin NI, Sprules T, Carpenter MR, Cotter PD, Hill C, Ross RP, Vederas JC.
    • Title

    • Structural characterization of lacticin 3147, a two-peptide lantibiotic with synergistic activity.
  • Literature 3
    • Reference

    • J Biol Chem. 1999 Dec 31;274(53):37544-37550.
    • Author

    • Ryan MP, Jack RW, Josten M, Sahl HG, Jung G, Ross RP, Hill C.
    • Title

    • Extensive post-translational modification, including serine to D-alanine conversion, in the two-component lantibiotic, lacticin 3147.