• DRAMP ID

    • DRAMP00014
    • Peptide Name

    • Geobacillin I (nisin analog; Bacteriocin)
    • Source

    • Geobacillus thermodenitrificans NG80-2 (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • sunA
    • Sequence

    • VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC
    • Sequence Length

    • 33
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Streptococcus dysgalatiae subsp dysgalactiae ATCC 27957 (IC50=0.69±0.05 µM), Vancomycin-resistant Enterococcusfaecium CNRZ 481 (IC50=0.84±0.05 µM), Methicillin-resistant Staphylococcus aureus C5 (IC50=2.23±0.03 µM), Bacillus anthracis Sterne 7702 (IC50=0.49±0.02 µM), Bacillus subtilis ATCC 6633 (IC50=0.55±0.01 µM), Lactococcus lactis HP ATCC 11602 (IC50=0.12±0.09 µM).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Extensive NMR characterization demonstrated that geobacillin I contains seven thioether cross-links, two more than the five cross-links found in nisin and the most cross-links found in any lantibiotic to date.
    • PDB ID

    • Unknow
    • DRAMP00014 helical wheel diagram
    • Formula

    • C136H238N40O46S8
    • Absent Amino Acids

    • ADEFHWY
    • Common Amino Acids

    • C
    • Mass

    • 3997.08
    • PI

    • 8.03
    • Basic Residues

    • 2
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 8
    • Boman Index

    • -16.66
    • Hydrophobicity

    • 73.64
    • Aliphatic Index

    • 85.45
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 11.72
    • Polar Residues

    • 20

DRAMP00014

DRAMP00014 chydropathy plot
    • Function

    • Geobacillin I is active against a wide range of Gram positive bacteria but it not active against Gram-negative bacterium E. coli.
    • PTM

    • Contains seven thioether cross-links.
    • Biophysicochemical properties

    • Geobacillin I is more stable than nisin at pH 7 and 8 at 37 and at 60 °C.
  • Literature 1
    • Reference

    • Proc Natl Acad Sci U S A. 2012 Apr 3;109(14):5241-5246.
    • Author

    • Garg N, Tang W, Goto Y, Nair SK, van der Donk WA.
    • Title

    • Lantibiotics from Geobacillus thermodenitrificans.