General Information

    • DRAMP ID

    • DRAMP00014

    • Peptide Name

    • Geobacillin I (nisin analog; Bacteriocin)

    • Source

    • Geobacillus thermodenitrificans NG80-2 (Gram-positive bacteria)

    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)

    • Gene

    • sunA

    • Sequence

    • VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC

    • Sequence Length

    • 33

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Streptococcus dysgalatiae subsp dysgalactiae ATCC 27957 (IC50=0.69±0.05 µM), Vancomycin-resistant Enterococcusfaecium CNRZ 481 (IC50=0.84±0.05 µM), Methicillin-resistant Staphylococcus aureus C5 (IC50=2.23±0.03 µM), Bacillus anthracis Sterne 7702 (IC50=0.49±0.02 µM), Bacillus subtilis ATCC 6633 (IC50=0.55±0.01 µM), Lactococcus lactis HP ATCC 11602 (IC50=0.12±0.09 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization between S29 and C33

    • Nonterminal Modifications and Unusual Amino Acids

    • Four lanthionines (S3-C7,S23-C27,S26-C30,S29-C33) and three β-methyllanthionines (T8-C11; T13-C18; T20-C24),S5 is dehydroalanines.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Extensive NMR characterization demonstrated that geobacillin I contains seven thioether cross-links, two more than the five cross-links found in nisin and the most cross-links found in any lantibiotic to date.

    • Helical Wheel Diagram

    • DRAMP00014 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00014.

Physicochemical Information

    • Formula

    • C136H238N40O46S8

    • Absent Amino Acids

    • ADEFHWY

    • Common Amino Acids

    • C

    • Mass

    • 3426.11

    • PI

    • 8.27

    • Basic Residues

    • 2

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -16.66

    • Hydrophobicity

    • 0.736

    • Aliphatic Index

    • 85.45

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 11.72

    • Polar Residues

    • 20

DRAMP00014

DRAMP00014 chydropathy plot

Comments Information

    • Function

    • Geobacillin I is active against a wide range of Gram positive bacteria but it not active against Gram-negative bacterium E. coli.

    • PTM

    • Contains seven thioether cross-links.

    • Biophysicochemical properties

    • Geobacillin I is more stable than nisin at pH 7 and 8 at 37 and at 60 °C.

Literature Information

  • ·Literature 1

    • Title

    • Lantibiotics from Geobacillus thermodenitrificans.

    • Reference

    • Proc Natl Acad Sci U S A. 2012 Apr 3;109(14):5241-5246.

    • Author

    • Garg N, Tang W, Goto Y, Nair SK, van der Donk WA.