• DRAMP ID

    • DRAMP00018
    • Peptide Name

    • SmbA1 (Bacteriocin)
    • Source

    • Streptococcus mutans GS5 (Gram-negative bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • Not found
    • Sequence

    • GTTVVNSTFSIVLGNKGYICTVTVECMRNCSK
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Rich
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00018 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00018.
    • Formula

    • C145H242N40O47S4
    • Absent Amino Acids

    • ADHPQW
    • Common Amino Acids

    • TV
    • Mass

    • 3426
    • PI

    • 8.66
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +2
    • Boman Index

    • -28.99
    • Hydrophobicity

    • 0.353
    • Aliphatic Index

    • 81.88
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 52.1
    • Polar Residues

    • 18

DRAMP00018

DRAMP00018 chydropathy plot
    • The two peptides (SmbA and SmbB) are encoded by two chromosomal DNA genes in the same operon.

  • ·Literature 1
    • Title

    • Genetic analysis of a unique bacteriocin, Smb, produced by Streptococcus mutans GS5.
    • Reference

    • Antimicrob Agents Chemother. 2005 Feb;49(2):541-548.
    • Author

    • Yonezawa H, Kuramitsu HK.