General Information

    • DRAMP ID

    • DRAMP00018

    • Peptide Name

    • SmbA1 (Bacteriocin)

    • Source

    • Streptococcus mutans GS5 (Gram-negative bacteria)

    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)

    • Gene

    • Not found

    • Sequence

    • GTTVVNSTFSIVLGNKGYICTVTVECMRNCSK

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Rich

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00018 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00018.

Physicochemical Information

    • Formula

    • C145H242N40O47S4

    • Absent Amino Acids

    • ADHPQW

    • Common Amino Acids

    • TV

    • Mass

    • 3426

    • PI

    • 8.66

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +2

    • Boman Index

    • -28.99

    • Hydrophobicity

    • 0.353

    • Aliphatic Index

    • 81.88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 52.1

    • Polar Residues

    • 18

DRAMP00018

DRAMP00018 chydropathy plot

Comments Information

    • The two peptides (SmbA and SmbB) are encoded by two chromosomal DNA genes in the same operon.

Literature Information

  • ·Literature 1

    • Title

    • Genetic analysis of a unique bacteriocin, Smb, produced by Streptococcus mutans GS5.

    • Reference

    • Antimicrob Agents Chemother. 2005 Feb;49(2):541-548.

    • Author

    • Yonezawa H, Kuramitsu HK.