General Information

    • DRAMP ID

    • DRAMP00022

    • Peptide Name

    • Staphylococcin C55alpha (SacAalpha; chain alpha of Staphylococcin C55; Bacteriocin)

    • Source

    • Staphylococcus aureus C55 (Gram-positive bacteria)

    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)

    • Gene

    • Not found

    • Sequence

    • CSTNTFSLSDYWGNKGNWCTATHECMSWCK

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus and Micrococcus luteus (C55alpha and C55beta work synergistically at a ratio of 1:1).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00022 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C148H210N40O47S5

    • Absent Amino Acids

    • IPQRV

    • Common Amino Acids

    • CST

    • Mass

    • 3461.84

    • PI

    • 6.72

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +1

    • Boman Index

    • -49.18

    • Hydrophobicity

    • -0.633

    • Aliphatic Index

    • 16.33

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18240

    • Absorbance 280nm

    • 628.97

    • Polar Residues

    • 18

DRAMP00022

DRAMP00022 chydropathy plot

Comments Information

    • Function

    • Active on certain Gram-positive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Two-component anti-Staphylococcus aureus lantibiotic activity produced by Staphylococcus aureus C55.

    • Reference

    • Appl Environ Microbiol. 1998 Dec;64(12):4803-4808.

    • Author

    • Navaratna MA, Sahl HG, Tagg JR.
  • ·Literature 2

    • Title

    • Identification of genes encoding two-component lantibiotic production in Staphylococcus aureus C55 and other phage group II Staphylococcus aureus strains and demonstration of an association with the exfoliative toxin B gene.

    • Reference

    • Infect Immun. 1999 Aug;67(8):4268-4271.

    • Author

    • Navaratna MA, Sahl HG, Tagg JR.