• DRAMP ID

    • DRAMP00022
    • Peptide Name

    • Staphylococcin C55alpha (SacAalpha; chain alpha of Staphylococcin C55; Bacteriocin)
    • Source

    • Staphylococcus aureus C55 (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • Unknow
    • Sequence

    • CSTNTFSLSDYWGNKGNWCTATHECMSWCK
    • Sequence Length

    • 30
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknow
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus and Micrococcus luteus (C55alpha and C55beta work synergistically at a ratio of 1:1).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Formula

    • C148H210N40O47S5
    • Absent Amino Acids

    • IPQRV
    • Common Amino Acids

    • CST
    • Mass

    • 3979.28
    • PI

    • 7.12
    • Basic Residues

    • 3
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 6
    • Boman Index

    • -49.18
    • Hydrophobicity

    • -63.33
    • Aliphatic Index

    • 16.33
    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18240
    • Absorbance 280nm

    • 628.97
    • Polar Residues

    • 18

DRAMP00022

DRAMP00022 chydropathy plot
    • Function

    • Active on certain Gram-positive bacteria.
  • Literature 1
    • Reference

    • Appl Environ Microbiol. 1998 Dec;64(12):4803-4808.
    • Author

    • Navaratna MA, Sahl HG, Tagg JR.
    • Title

    • Two-component anti-Staphylococcus aureus lantibiotic activity produced by Staphylococcus aureus C55.
  • Literature 2
    • Reference

    • Infect Immun. 1999 Aug;67(8):4268-4271.
    • Author

    • Navaratna MA, Sahl HG, Tagg JR.
    • Title

    • Identification of genes encoding two-component lantibiotic production in Staphylococcus aureus C55 and other phage group II Staphylococcus aureus strains and demonstration of an association with the exfoliative toxin B gene.