General Information

    • DRAMP ID

    • DRAMP00025

    • Peptide Name

    • CylLL (a structural subunit of cytolysin; Bacteriocin)

    • Source

    • Enterococcus faecalis (Gram-positive bacteria)

    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)

    • Gene

    • Not found

    • Sequence

    • TTPVCAVAATAAASSAACGWVGGGIFTGVTVVVSLKHC

    • Sequence Length

    • 38

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00025 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00025.

Physicochemical Information

    • Formula

    • C156H252N42O47S3

    • Absent Amino Acids

    • DEMNQRY

    • Common Amino Acids

    • A

    • Mass

    • 3564.15

    • PI

    • 7.68

    • Basic Residues

    • 2

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +2

    • Boman Index

    • 33.19

    • Hydrophobicity

    • 1.182

    • Aliphatic Index

    • 95

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 152.03

    • Polar Residues

    • 16

DRAMP00025

DRAMP00025 chydropathy plot

Comments Information

    • CylLL and CylLS are activated by an extracellular protease, CylA.

Literature Information

  • ·Literature 1

    • Title

    • Structural analysis and proteolytic activation of Enterococcus faecalis cytolysin, a novel lantibiotic.

    • Reference

    • Mol Microbiol. 1996 Sep;21(6):1175-1184.

    • Author

    • Booth MC, Bogie CP, Sahl HG, Siezen RJ, Hatter KL, Gilmore MS.