• DRAMP ID

    • DRAMP00025
    • Peptide Name

    • CylLL (a structural subunit of cytolysin; Bacteriocin)
    • Source

    • Enterococcus faecalis (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • Not found
    • Sequence

    • TTPVCAVAATAAASSAACGWVGGGIFTGVTVVVSLKHC
    • Sequence Length

    • 38
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Not found
    • Biological Activity

    • Antibacterial, Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • Not found
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • DRAMP00025 helical wheel diagram
    • Formula

    • C156H252N42O47S3
    • Absent Amino Acids

    • DEMNQRY
    • Common Amino Acids

    • A
    • Mass

    • 4224.33
    • PI

    • 8.06
    • Basic Residues

    • 2
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 19
    • Boman Index

    • 33.19
    • Hydrophobicity

    • 1.182
    • Aliphatic Index

    • 95
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 152.03
    • Polar Residues

    • 16

DRAMP00025

DRAMP00025 chydropathy plot
    • CylLL and CylLS are activated by an extracellular protease, CylA.

  • ·Literature 1
    • Title

    • Structural analysis and proteolytic activation of Enterococcus faecalis cytolysin, a novel lantibiotic.
    • Reference

    • Mol Microbiol. 1996 Sep;21(6):1175-1184.
    • Author

    • Booth MC, Bogie CP, Sahl HG, Siezen RJ, Hatter KL, Gilmore MS.