• DRAMP ID

    • DRAMP00048
    • Peptide Name

    • Lantibiotic subtilin (Bacteriocin)
    • Source

    • Bacillus subtilis (Gram-positive bacteria)
    • Family

    • Belongs to the type A lantibiotic family (Class I bacteriocin)
    • Gene

    • spaS
    • Sequence

    • WKSESLCTPGCVTGALQTCFLQTLTCNCKISK
    • Sequence Length

    • 32
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Lipid II
    • Structure

    • Rich
    • Structure Description

    • Unknown
    • DRAMP00048 helical wheel diagram
    • Formula

    • C148H243N39O46S5
    • Absent Amino Acids

    • DHMRY
    • Common Amino Acids

    • CT
    • Mass

    • 4018.23
    • PI

    • 8.21
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -20.19
    • Hydrophobicity

    • 19.06
    • Aliphatic Index

    • 73.13
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5750
    • Absorbance 280nm

    • 185.48
    • Polar Residues

    • 16

DRAMP00048

DRAMP00048 chydropathy plot
    • Function Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores.

    • PTM

    • Maturation of lantibiotics involves the enzymic conversion of Thr, and Ser into dehydrated AA and the formation of thioether bonds with cysteine. This is followed by membrane translocation and cleavage of the modified precursor.Succinylated subtilin is 10-20 times less active than subtilin. The ratio subtilin/succinylated subtilin is about 1
  • Literature 1
    • Reference

    • Hoppe Seylers Z Physiol Chem. 1973 Jul;354(7):810-812.
    • Author

    • Gross E, Kiltz HH, Nebelin E.
    • Title

    • Subtilin, VI: the structure of subtilin (author's transl).