• DRAMP ID

    • DRAMP00048
    • Peptide Name

    • Lantibiotic subtilin (Bacteriocin)
    • Source

    • Bacillus subtilis (Gram-positive bacteria)
    • Family

    • Belongs to the type A lantibiotic family (Class I bacteriocin)
    • Gene

    • spaS
    • Sequence

    • WKSESLCTPGCVTGALQTCFLQTLTCNCKISK
    • Sequence Length

    • 32
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Lipid II
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Succinylation
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • There are two dehydroalanines (S5; S31),one dehydrobutyrine (T18),one lanthionine (S3-C7) and four β-methyllanthionines (T8-C11; T13-C19; T23-C26; T25-C28).
    • Stereochemistry

    • L
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C148H243N39O46S5
    • Absent Amino Acids

    • DHMRY
    • Common Amino Acids

    • CT
    • Mass

    • 3465.09
    • PI

    • 8.42
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +2
    • Boman Index

    • -20.19
    • Hydrophobicity

    • 0.191
    • Aliphatic Index

    • 73.13
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5750
    • Absorbance 280nm

    • 185.48
    • Polar Residues

    • 16

DRAMP00048

    • Function Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores.

    • PTM

    • Maturation of lantibiotics involves the enzymic conversion of Thr, and Ser into dehydrated AA and the formation of thioether bonds with cysteine. This is followed by membrane translocation and cleavage of the modified precursor.Succinylated subtilin is 10-20 times less active than subtilin. The ratio subtilin/succinylated subtilin is about 1
  • ·Literature 1
    • Title

    • Subtilin, VI: the structure of subtilin (author's transl).
    • Reference

    • Hoppe Seylers Z Physiol Chem. 1973 Jul;354(7):810-812.
    • Author

    • Gross E, Kiltz HH, Nebelin E.
  • ·Literature 2
    • Title

    • Entianin, a novel subtilin-like lantibiotic from Bacillus subtilis subsp. spizizenii DSM 15029T with high antimicrobial activity
    • Reference

    • Appl Environ Microbiol . 2011 Mar;77(5):1698-707.
    • Author

    • Sebastian W Fuchs, Thorsten W Jaskolla, Sophie Bochmann, Peter Kötter, Thomas Wichelhaus, Michael Karas, Torsten Stein, Karl-Dieter Entian