• DRAMP ID

    • DRAMP00064
    • Peptide Name

    • Enterocin 96 (Bacteriocin)
    • Source

    • Enterococcus faecalis (strain ATCC 700802 / V583) (Gram-positive bacteria)
    • Family

    • Belongs to the class II bacteriocin
    • Gene

    • Not found
    • Sequence

    • MSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDSSDPAGCNDIVRKYCK
    • Sequence Length

    • 48
    • Evidence code

    • Predicted
    • Biological Activity

    • Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis, E. faecium WHE, E. hirae, E. pseudoavium, E. sulfureus, E. saccharolyticus, E. columbae, Lactobacillus plantarum, L. acidophilus, Lactobacillus sakeii subsp. sakei, L. paracasei subsp. paracasei, Lactococcus lactis, Lactococcus lactis subsp. cremoris, Leuconostoc mesenteroides, Bacillus subtilis, Bacillus cereus, Listeria innocua, Listeria monocytogenes, Staphylococcus xylosus, Staphylococcus aureus;
      • Gram-negative bacteria: Salmonella enterica serovar Typhimurium, S. enterica serovar Infantis, Klebsiella pneumoniae, Serratia liquefaciens, Proteus vulgaris, Enterobacter cloacae, Escherichia coli.
    • Hemolytic Activity

      • Not found
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • DRAMP00064 helical wheel diagram
    • Formula

    • C214H355N67O68S7
    • Absent Amino Acids

    • EFW
    • Common Amino Acids

    • AC
    • Mass

    • 6017.56
    • PI

    • 8.5
    • Basic Residues

    • 8
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 13
    • Boman Index

    • -86.9
    • Hydrophobicity

    • -0.252
    • Aliphatic Index

    • 71.25
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3230
    • Absorbance 280nm

    • 68.72
    • Polar Residues

    • 19

DRAMP00064

DRAMP00064 chydropathy plot
  • ·Literature 1
    • Title

    • Role of mobile DNA in the evolution of vancomycin-resistant Enterococcus faecalis.
    • Reference

    • Science. 2003 Mar 28;299(5615):2071-2074.
    • Author

    • Paulsen IT, Banerjei L, Myers GS, Nelson KE, Seshadri R, Read TD, Fouts DE, Eisen JA, Gill SR, Heidelberg JF, Tettelin H, Dodson RJ, Umayam L, Brinkac L, Beanan M, Daugherty S, DeBoy RT, Durkin S, Kolonay J, Madupu R, Nelson W, Vamathevan J, Tran B, Upton J, Hansen T, Shetty J, Khouri H, Utterback T, Radune D, Ketchum KA, Dougherty BA, Fraser CM.