General Information

    • DRAMP ID

    • DRAMP00064

    • Peptide Name

    • Enterocin 96 (Bacteriocin)

    • Source

    • Enterococcus faecalis (strain ATCC 700802 / V583) (Gram-positive bacteria)

    • Family

    • Belongs to the class II bacteriocin

    • Gene

    • Not found

    • Sequence

    • MSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDSSDPAGCNDIVRKYCK

    • Sequence Length

    • 48

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis, E. faecium WHE, E. hirae, E. pseudoavium, E. sulfureus, E. saccharolyticus, E. columbae, Lactobacillus plantarum, L. acidophilus, Lactobacillus sakeii subsp. sakei, L. paracasei subsp. paracasei, Lactococcus lactis, Lactococcus lactis subsp. cremoris, Leuconostoc mesenteroides, Bacillus subtilis, Bacillus cereus, Listeria innocua, Listeria monocytogenes, Staphylococcus xylosus, Staphylococcus aureus;
      • Gram-negative bacteria: Salmonella enterica serovar Typhimurium, S. enterica serovar Infantis, Klebsiella pneumoniae, Serratia liquefaciens, Proteus vulgaris, Enterobacter cloacae, Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00064 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00064.

Physicochemical Information

    • Formula

    • C214H355N67O68S7

    • Absent Amino Acids

    • EFW

    • Common Amino Acids

    • AC

    • Mass

    • 5179

    • PI

    • 8.72

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +4

    • Boman Index

    • -86.9

    • Hydrophobicity

    • -0.252

    • Aliphatic Index

    • 71.25

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3230

    • Absorbance 280nm

    • 68.72

    • Polar Residues

    • 19

DRAMP00064

DRAMP00064 chydropathy plot

Comments Information

    • Search in protein databases revealed that enterocin 96 was identical to the C-terminal part of a putative uncharacterized protein from Enterococcus faecalis V583 (accession number EF_B0056) identified after complete genome sequencing of this strain. The amino acid sequence of this protein contains an N-terminal extension of 26 amino acids with two C-terminal 1 glycyl residues. The likely presence of such an extension for enterocin 96 was investigated by sequencing its structural gene.

Literature Information

  • ·Literature 1

    • Title

    • Role of mobile DNA in the evolution of vancomycin-resistant Enterococcus faecalis.

    • Reference

    • Science. 2003 Mar 28;299(5615):2071-2074.

    • Author

    • Paulsen IT, Banerjei L, Myers GS, Nelson KE, Seshadri R, Read TD, Fouts DE, Eisen JA, Gill SR, Heidelberg JF, Tettelin H, Dodson RJ, Umayam L, Brinkac L, Beanan M, Daugherty S, DeBoy RT, Durkin S, Kolonay J, Madupu R, Nelson W, Vamathevan J, Tran B, Upton J, Hansen T, Shetty J, Khouri H, Utterback T, Radune D, Ketchum KA, Dougherty BA, Fraser CM.