• • DRAMP ID

  • DRAMP00064

• • Peptide Name

  • Enterocin 96 (Bacteriocin)

• • Source

  • Enterococcus faecalis (strain ATCC 700802 / V583) (Gram-positive bacteria)

• • Family

  • Belongs to the class II bacteriocin

• • Gene

  • Not found

• • Sequence

  • MSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDSSDPAGCNDIVRKYCK

• • Sequence Length

  • 48

• • Swiss_Prot Entry

  • Q82YI9

• • Evidence code

  • Predicted

• • Biological Activity

  • Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial

• • Target Organism

  • • Gram-positive bacteria: Enterococcus faecalis, E. faecium WHE, E. hirae, E. pseudoavium, E. sulfureus, E. saccharolyticus, E. columbae, Lactobacillus plantarum, L. acidophilus, Lactobacillus sakeii subsp. sakei, L. paracasei subsp. paracasei, Lactococcus lactis, Lactococcus lactis subsp. cremoris, Leuconostoc mesenteroides, Bacillus subtilis, Bacillus cereus, Listeria innocua, Listeria monocytogenes, Staphylococcus xylosus, Staphylococcus aureus;
    • Gram-negative bacteria: Salmonella enterica serovar Typhimurium, S. enterica serovar Infantis, Klebsiella pneumoniae, Serratia liquefaciens, Proteus vulgaris, Enterobacter cloacae, Escherichia coli.

• • Hemolytic Activity

  • • Not found

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Other Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

  • None
• • 

DRAMP00064

• • Search in protein databases revealed that enterocin 96 was identical to the C-terminal part of a putative uncharacterized protein from Enterococcus faecalis V583 (accession number EF_B0056) identified after complete genome sequencing of this strain. The amino acid sequence of this protein contains an N-terminal extension of 26 amino acids with two C-terminal 1 glycyl residues. The likely presence of such an extension for enterocin 96 was investigated by sequencing its structural gene.

• ·Literature 1

• • Title

  • Role of mobile DNA in the evolution of vancomycin-resistant Enterococcus faecalis.

• • Pubmed ID

  • 12663927

• • Reference

  • Science. 2003 Mar 28;299(5615):2071-2074.

• • Author

  • Paulsen IT, Banerjei L, Myers GS, Nelson KE, Seshadri R, Read TD, Fouts DE, Eisen JA, Gill SR, Heidelberg JF, Tettelin H, Dodson RJ, Umayam L, Brinkac L, Beanan M, Daugherty S, DeBoy RT, Durkin S, Kolonay J, Madupu R, Nelson W, Vamathevan J, Tran B, Upton J, Hansen T, Shetty J, Khouri H, Utterback T, Radune D, Ketchum KA, Dougherty BA, Fraser CM.