General Information

    • DRAMP ID

    • DRAMP00066

    • Peptide Name

    • Lacticin Q (Bacteriocin)

    • Source

    • Lactococcus lactis QU 5 (Gram-positive bacteria)

    • Family

    • Belongs to the class II bacteriocin

    • Gene

    • lnqQ

    • Sequence

    • AGFLKVVQLLAKYGSKAVQWAWANKGKILDWLNAGQAIDWVVSKIKQILGIK

    • Sequence Length

    • 52

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus cereus JCM 2152, Bacillus circulans JCM 2504, Bacillus coagulans JCM 2257, Bacillus subtilis JCM 1465, Enterococcus faecalis JCM 5803, Enterococcus faecium JCM 5804, Enterococcus mundtii QU 2, Enterococcus hirae ATCC 10541, Lactococcus lactis ATCC 19435, Lactococcus lactis NCDO 497, Lactobacillus acidophilus JCM 1132, Lactobacillus alimentarius JCM 1095, Lactobacillus brevis JCM 1059, Lactobacillus casei JCM 1134, Lactobacillus coryniformis JCM 1164, Lactobacillus sakeii JCM 1157, Leuconostoc mesenteroides JCM 6124, Listeria innocua ATCC 33090, Micrococcus luteus IFO 12708, Pediococcus pentosaceus JCM 5885.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00066 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00066.

Physicochemical Information

    • Formula

    • C274H436N70O66

    • Absent Amino Acids

    • CEHMPRT

    • Common Amino Acids

    • KA

    • Mass

    • 5766.9

    • PI

    • 10.1

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +6

    • Boman Index

    • -0.23

    • Hydrophobicity

    • 0.269

    • Aliphatic Index

    • 123.85

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 23490

    • Absorbance 280nm

    • 460.59

    • Polar Residues

    • 10

DRAMP00066

DRAMP00066 chydropathy plot

Comments Information

    • Lacticin Q was very stable against heat treatment and changes in pH; in particular, it was stable at alkaline pH values, while nisin A was inactivated. Moreover, lacticin Q induced ATP efflux from a Listeria sp. strain in a shorter time and at a lower concentration than nisin A, indicating that the former affected indicator cells in a different manner from that of the latter.

Literature Information

  • ·Literature 1

    • Title

    • Structural analysis and characterization of lacticin Q, a novel bacteriocin belonging to a new family of unmodified bacteriocins of gram-positive bacteria.

    • Reference

    • Appl Environ Microbiol. 2007 May;73(9):2871-2877.

    • Author

    • Fujita K, Ichimasa S, Zendo T, Koga S, Yoneyama F, Nakayama J, Sonomoto K.