General Information

    • DRAMP ID

    • DRAMP00066

    • Peptide Name

    • Lacticin Q (Bacteriocin)

    • Source

    • Lactococcus lactis QU 5 (Gram-positive bacteria)

    • Family

    • Belongs to the class II bacteriocin

    • Gene

    • lnqQ

    • Sequence

    • AGFLKVVQLLAKYGSKAVQWAWANKGKILDWLNAGQAIDWVVSKIKQILGIK

    • Sequence Length

    • 52

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus cereus JCM 2152-
        Bacillus circulans JCM 2504-
        Bacillus coagulans JCM 2257-
        Bacillus subtilis JCM 1465-
        Enterococcus faecalis JCM 5803-
        Enterococcus faecium JCM 5804-
        Enterococcus mundtii QU 2-
        Enterococcus hirae ATCC 10541-
        Lactococcus lactis ATCC 19435-
        Lactococcus lactis NCDO 497-
        Lactobacillus acidophilus JCM 1132-
        Lactobacillus alimentarius JCM 1095-
        Lactobacillus brevis JCM 1059-
        Lactobacillus casei JCM 1134-
        Lactobacillus coryniformis JCM 1164-
        Lactobacillus sakeii JCM 1157-
        Leuconostoc mesenteroides JCM 6124-
        Listeria innocua ATCC 33090-
        Micrococcus luteus IFO 12708-
        Pediococcus pentosaceus JCM 5885-

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00066 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00066.

Physicochemical Information

    • Formula

    • C274H436N70O66

    • Absent Amino Acids

    • CEHMPRT

    • Common Amino Acids

    • KA

    • Mass

    • 5766.9

    • PI

    • 10.1

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +6

    • Boman Index

    • -0.23

    • Hydrophobicity

    • 0.269

    • Aliphatic Index

    • 123.85

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 23490

    • Absorbance 280nm

    • 460.59

    • Polar Residues

    • 10

DRAMP00066

DRAMP00066 chydropathy plot

Comments Information

    • Lacticin Q was very stable against heat treatment and changes in pH; in particular, it was stable at alkaline pH values, while nisin A was inactivated. Moreover, lacticin Q induced ATP efflux from a Listeria sp. strain in a shorter time and at a lower concentration than nisin A, indicating that the former affected indicator cells in a different manner from that of the latter.

Literature Information

  • ·Literature 1

    • Title

    • Structural analysis and characterization of lacticin Q, a novel bacteriocin belonging to a new family of unmodified bacteriocins of gram-positive bacteria.

    • Reference

    • Appl Environ Microbiol. 2007 May;73(9):2871-2877.

    • Author

    • Fujita K, Ichimasa S, Zendo T, Koga S, Yoneyama F, Nakayama J, Sonomoto K.