• DRAMP ID

    • DRAMP00067
    • Peptide Name

    • Leucocin C-TA33a (Bacteriocin)
    • Source

    • Leuconostoc mesenteroides TA33a (Gram-positive bacteria)
    • Family

    • Belongs to the class II bacteriocin
    • Gene

    • Not found
    • Sequence

    • KNYGNGVHCTKKGCSVDWGYAATNIANNSVMNGLTG
    • Sequence Length

    • 36
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Not found
    • Biological Activity

    • Antibacterial, Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • Not found
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • DRAMP00067 helical wheel diagram
    • Formula

    • C158H246N48O52S3
    • Absent Amino Acids

    • EFPQR
    • Common Amino Acids

    • GN
    • Mass

    • 4370.65
    • PI

    • 8.76
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -44.39
    • Hydrophobicity

    • -0.439
    • Aliphatic Index

    • 54.17
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 245.86
    • Polar Residues

    • 21

DRAMP00067

DRAMP00067 chydropathy plot
    • No comments found on DRAMP database

  • ·Literature 1
    • Title

    • Sequence and structural relationships of leucocins A-, B- and C-TA33a from Leuconostoc mesenteroides TA33a.
    • Reference

    • Microbiology. 1998 May;144 (Pt 5):1343-1348.
    • Author

    • Papathanasopoulos MA, Dykes GA, Revol-Junelles AM, Delfour A, von Holy A, Hastings JW.