• DRAMP ID

    • DRAMP00069
    • Peptide Name

    • Garvieacin Q (GarQ; Bacteriocin)
    • Source

    • Lactococcus garvieae BCC 43578 (Gram-positive bacteria)
    • Family

    • Belongs to the class II bacteriocin
    • Gene

    • Not found
    • Sequence

    • EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH
    • Sequence Length

    • 50
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria: Bacillus coagulans JCM 2257, Listeria monocytogenes ATCC 19115, L. garvieae strains, E. faecium D48S52, Lactobacillus plantarum BCC 9546, Lactobacillus sakeii JCM 1157, L. ivanovii DMST 9012 (MIC=0.1-1.6 uM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.22210221] Purified GarQ, up to 1 mg/mL, was not cytotoxic to Vero (African green monkey kidney), HepG (human liver hepatocarcinoma) and Caco-2 (human colon adenocarcinoma) cell lines. Vero, HepG2 and Caco-2 have 94 ± 8, 97 ± 4 and 89 ± 7 % survival with indicated concentration (1mg/mL) of purified garvieacin Q compared to that of untreated control using the MTT assay.
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00069 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00069.
    • Formula

    • C237H358N68O69S2
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • G
    • Mass

    • 5327.98
    • PI

    • 9.06
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +4
    • Boman Index

    • -50.54
    • Hydrophobicity

    • -0.178
    • Aliphatic Index

    • 66.2
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 9970
    • Absorbance 280nm

    • 203.47
    • Polar Residues

    • 22

DRAMP00069

DRAMP00069 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Garvieacin Q, a novel class II bacteriocin from Lactococcus garvieae BCC 43578.
    • Reference

    • Appl Environ Microbiol. 2012 Mar;78(5):1619-1623.
    • Author

    • Tosukhowong A, Zendo T, Visessanguan W, Roytrakul S, Pumpuang L, Jaresitthikunchai J, Sonomoto K.