General Information

    • DRAMP ID

    • DRAMP00069

    • Peptide Name

    • Garvieacin Q (GarQ; Bacteriocin)

    • Source

    • Lactococcus garvieae BCC 43578 (Gram-positive bacteria)

    • Family

    • Belongs to the class II bacteriocin

    • Gene

    • Not found

    • Sequence

    • EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus coagulans JCM 2257, Listeria monocytogenes ATCC 19115, L. garvieae strains, E. faecium D48S52, Lactobacillus plantarum BCC 9546, Lactobacillus sakeii JCM 1157, L. ivanovii DMST 9012 (MIC=0.1-1.6 uM).

    • Hemolytic Activity

      • Not found

    • Cytotoxicity

      • [Ref.22210221] Purified GarQ, up to 1 mg/mL, was not cytotoxic to Vero (African green monkey kidney), HepG (human liver hepatocarcinoma) and Caco-2 (human colon adenocarcinoma) cell lines. Vero, HepG2 and Caco-2 have 94 ± 8, 97 ± 4 and 89 ± 7 % survival with indicated concentration (1mg/mL) of purified garvieacin Q compared to that of untreated control using the MTT assay.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

Physicochemical Information

    • Formula

    • C237H358N68O69S2

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • G

    • Mass

    • 5327.98

    • PI

    • 9.06

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +4

    • Boman Index

    • -50.54

    • Hydrophobicity

    • -0.178

    • Aliphatic Index

    • 66.2

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 203.47

    • Polar Residues

    • 22

DRAMP00069

DRAMP00069 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Garvieacin Q, a novel class II bacteriocin from Lactococcus garvieae BCC 43578.

    • Reference

    • Appl Environ Microbiol. 2012 Mar;78(5):1619-1623.

    • Author

    • Tosukhowong A, Zendo T, Visessanguan W, Roytrakul S, Pumpuang L, Jaresitthikunchai J, Sonomoto K.