• • DRAMP ID

  • DRAMP00069

• • Peptide Name

  • Garvieacin Q (GarQ; Bacteriocin)

• • Source

  • Lactococcus garvieae BCC 43578 (Gram-positive bacteria)

• • Family

  • Belongs to the class II bacteriocin

• • Gene

  • N/A

• • Sequence

  • EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH

• • Sequence Length

  • 50

• • Swiss_Prot Entry

  • No entry found

• • Evidence code

  • N/A

• • Biological Activity

  • Antibacterial, Anti-Gram+, Antimicrobial

• • Target Organism

  • • Gram-positive bacteria: Bacillus coagulans JCM 2257, Listeria monocytogenes ATCC 19115, L. garvieae strains, E. faecium D48S52, Lactobacillus plantarum BCC 9546, Lactobacillus sakeii JCM 1157, L. ivanovii DMST 9012 (MIC=0.1-1.6 uM).

• • Hemolytic Activity

  • • N/A

• • Cytotoxicity

• • Binding Target

  • N/A

• • Linear/Cyclic/Branched

• • N-terminal modification

• • C-terminal modification

• • Other modifications

• • Stereochemistry

• • Structure

  • N/A

• • Structure Description

  • N/A

• • PDB ID

  • N/A

• • 
  • 
  • Please click DRAMP00069_predicted_structure.pdb to download.

DRAMP00069

• • No comments found on DRAMP database

• Literature 1

• • Pubmed ID

  • 22210221

• • Reference

  • Appl Environ Microbiol. 2012 Mar;78(5):1619-1623.

• • Author

  • Tosukhowong A, Zendo T, Visessanguan W, Roytrakul S, Pumpuang L, Jaresitthikunchai J, Sonomoto K.

• • Title

  • Garvieacin Q, a novel class II bacteriocin from Lactococcus garvieae BCC 43578.