General Information

    • DRAMP ID

    • DRAMP00070

    • Peptide Name

    • Laterosporulin (Bacteriocin)

    • Source

    • Brevibacillus sp. Strain GI-9 (Gram-positive bacteria)

    • Family

    • Belongs to the class II bacteriocin

    • Gene

    • Not found

    • Sequence

    • ACQCPDAISGWTHTDYQCHGLENKMYRHVYAICMNGTQVYCRTEWGSSC

    • Sequence Length

    • 49

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis, Staphylococcus aureus, Listeria monocytogenesa;
      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00070 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00070.

Physicochemical Information

    • Formula

    • C238H351N69O74S8

    • Absent Amino Acids

    • F

    • Common Amino Acids

    • C

    • Mass

    • 5619.3

    • PI

    • 6.27

    • Basic Residues

    • 6

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +2

    • Boman Index

    • -82.3

    • Hydrophobicity

    • -0.49

    • Aliphatic Index

    • 41.84

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 361.15

    • Polar Residues

    • 23

DRAMP00070

DRAMP00070 chydropathy plot

Comments Information

    • The bacteriocin was produced after 12 hours in the lag phase and the use of Diaion HP-20 hydrophobic resin increased yield. Partial sequence was determined and the entire sequence was deduced. This peptide is thermal stable, pH tolerant, and resistant to proteases. Reducing agent DTT had no effect on peptide activity or migration on gel.

Literature Information

  • ·Literature 1

    • Title

    • Identification, Purification and Characterization of Laterosporulin, a Novel Bacteriocin Produced by Brevibacillus sp. Strain GI-9.

    • Reference

    • PLoS One. 2012;7(3):e31498.

    • Author

    • Singh PK, Chittpurna, Ashish, Sharma V, Patil PB, Korpole S.