• DRAMP ID

    • DRAMP00070
    • Peptide Name

    • Laterosporulin (Bacteriocin)
    • Source

    • Brevibacillus sp. Strain GI-9 (Gram-positive bacteria)
    • Family

    • Belongs to the class II bacteriocin
    • Gene

    • N/A
    • Sequence

    • ACQCPDAISGWTHTDYQCHGLENKMYRHVYAICMNGTQVYCRTEWGSSC
    • Sequence Length

    • 49
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • N/A
    • Biological Activity

    • Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis, Staphylococcus aureus, Listeria monocytogenesa;
      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa.
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • N/A
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP00070 helical wheel diagram
    • Formula

    • C238H351N69O74S8
    • Absent Amino Acids

    • F
    • Common Amino Acids

    • C
    • Mass

    • 6475.68
    • PI

    • 6.73
    • Basic Residues

    • 6
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -82.3
    • Hydrophobicity

    • -48.98
    • Aliphatic Index

    • 41.84
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 17335
    • Absorbance 280nm

    • 361.15
    • Polar Residues

    • 23

DRAMP00070

DRAMP00070 chydropathy plot
    • The bacteriocin was produced after 12 hours in the lag phase and the use of Diaion HP-20 hydrophobic resin increased yield. Partial sequence was determined and the entire sequence was deduced. This peptide is thermal stable, pH tolerant, and resistant to proteases. Reducing agent DTT had no effect on peptide activity or migration on gel.

  • Literature 1
    • Title

    • Identification, Purification and Characterization of Laterosporulin, a Novel Bacteriocin Produced by Brevibacillus sp. Strain GI-9.
    • Reference

    • PLoS One. 2012;7(3):e31498.
    • Author

    • Singh PK, Chittpurna, Ashish, Sharma V, Patil PB, Korpole S.