• DRAMP ID

    • DRAMP00072
    • Peptide Name

    • Bacteriocin curvaticin
    • Source

    • Lactobacillus curvatus L442 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Not found
    • Sequence

    • AYPGNGVHCGKYSCTVDKQTAIGNIGNNAA
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes, Lactobacillus sakeii, Lactobacillus plantarum, Lactobacillus farciminis.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00072 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00072.
    • Formula

    • C127H199N39O43S2
    • Absent Amino Acids

    • EFLMRW
    • Common Amino Acids

    • G
    • Mass

    • 3024.33
    • PI

    • 8.07
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +2
    • Boman Index

    • -32.98
    • Hydrophobicity

    • -0.36
    • Aliphatic Index

    • 58.67
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3105
    • Absorbance 280nm

    • 107.07
    • Polar Residues

    • 16

DRAMP00072

DRAMP00072 chydropathy plot
    • Function

    • Has antibacterial activity.
    • PTM

    • Problely contains one disulfide bond 9-14.
    • Biophysicochemical properties

    • pH dependence (Stable below pH 6) and Temperature dependence (Stable below 60 degrees Celsius. Activity decreases sharply at temperatures above 60 degrees Celsius).
  • ·Literature 1
    • Title

    • Purification and characterization of curvaticin L442, a bacteriocin produced by Lactobacillus curvatus L442.
    • Reference

    • Antonie Van Leeuwenhoek. 2006 Jan;89(1):19-26.
    • Author

    • Xiraphi N, Georgalaki M, Driessche GV, Devreese B, Beeumen JV, Tsakalidou E, Metaxopoulos J, Drosinos EH.