General Information

    • DRAMP ID

    • DRAMP00072

    • Peptide Name

    • Bacteriocin curvaticin

    • Source

    • Lactobacillus curvatus L442 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • AYPGNGVHCGKYSCTVDKQTAIGNIGNNAA

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes, Lactobacillus sakeii, Lactobacillus plantarum, Lactobacillus farciminis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00072 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00072.

Physicochemical Information

    • Formula

    • C127H199N39O43S2

    • Absent Amino Acids

    • EFLMRW

    • Common Amino Acids

    • G

    • Mass

    • 3024.33

    • PI

    • 8.07

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -32.98

    • Hydrophobicity

    • -0.36

    • Aliphatic Index

    • 58.67

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3105

    • Absorbance 280nm

    • 107.07

    • Polar Residues

    • 16

DRAMP00072

DRAMP00072 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Problely contains one disulfide bond 9-14.

    • Biophysicochemical properties

    • pH dependence (Stable below pH 6) and Temperature dependence (Stable below 60 degrees Celsius. Activity decreases sharply at temperatures above 60 degrees Celsius).

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of curvaticin L442, a bacteriocin produced by Lactobacillus curvatus L442.

    • Reference

    • Antonie Van Leeuwenhoek. 2006 Jan;89(1):19-26.

    • Author

    • Xiraphi N, Georgalaki M, Driessche GV, Devreese B, Beeumen JV, Tsakalidou E, Metaxopoulos J, Drosinos EH.