General Information

    • DRAMP ID

    • DRAMP00073

    • Peptide Name

    • Weissellin-A (Bacteriocin)

    • Source

    • Weissella paramesenteroides DX (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • KNYGNGVYCNKHKCSVDWATFSANIANNSVAMAGLTGGNAGNK

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Myotis flavus strain ATCC 400-
        Micrococcus luteus strain CECT241-
        C. soprogenes strain NCTC533-
        Listeria monocytogenes strain ATCC 19111-
        L.inocua strain ATCC BAA-680D and Staphylococcus carnosus strain LMG13564 (+++); Bacillus cereus strain LMG13569-
        C. thiaminolyticum strain ATCC 15579-
        Enterococcus faecalis strain NCTC8176-
        Lactococcus lactis strain LM0230-
        Lactobacillus casei strain ATCC 344-
        Lactococcus lactis strain IL1403-
        L. jensenii strain ATCC 25258-
        Lactobacillus plantarum strain CECT220-
        L. brevis strain ATCC 8287-
        L. bulgaricus strain LMG13551-
        Pediococcus acidilactici strain ATCC 25740-
        P. pentosaceus strain ATCC 33316 and P. pentosaceus strain LMG13560 (+). Leuconostoc mesenteroides strain ATCC 19254-
        Lactococcus lactis strain ATCC 1454-
        L. sakei strain CECT906T-
        Lactococcus lactis subsp. cremoris strain MC1363 and L. curvatus strain ATCC 51436++

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00073 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00073.

Physicochemical Information

    • Formula

    • C189H292N58O61S3

    • Absent Amino Acids

    • EPQR

    • Common Amino Acids

    • N

    • Mass

    • 4448.93

    • PI

    • 9.19

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +4

    • Boman Index

    • -55.64

    • Hydrophobicity

    • -0.433

    • Aliphatic Index

    • 52.33

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8605

    • Absorbance 280nm

    • 204.88

    • Polar Residues

    • 23

DRAMP00073

DRAMP00073 chydropathy plot

Comments Information

    • Function

    • The mode of action appears to be non-lytic. Inactivated by proteinase K, but insensitive to trypsin, alpha-chymotrypsin, pepsin and papain.

    • Biophysicochemical properties

    • pH dependence (Remains active between pH 2 and 10); Temperature dependence (Remains active after incubation at 121 degrees Celsius for 1 hour).

    • PTM

    • Contains one disulfide bond 9-14.

Literature Information

  • ·Literature 1

    • Title

    • Purification, amino acid sequence and characterization of the class IIa bacteriocin weissellin A, produced by Weissella paramesenteroides DX.

    • Reference

    • Bioresour Technol. 2011 Jun;102(12):6730-6734.

    • Author

    • Papagianni M, Papamichael EM.