• • DRAMP ID

  • DRAMP00073

• • Peptide Name

  • Weissellin-A (Bacteriocin)

• • Source

  • Weissella paramesenteroides DX (Gram-positive bacteria)

• • Family

  • Belongs to the class IIa bacteriocin

• • Gene

  • Not found

• • Sequence

  • KNYGNGVYCNKHKCSVDWATFSANIANNSVAMAGLTGGNAGNK

• • Sequence Length

  • 43

• • UniProt Entry

  • B3A0N4

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • Gram-positive bacteria: Myotis flavus strain ATCC 400, Micrococcus luteus strain CECT241, C. soprogenes strain NCTC533, Listeria monocytogenes strain ATCC 19111, L.inocua strain ATCC BAA-680D and Staphylococcus carnosus strain LMG13564 (+++); Bacillus cereus strain LMG13569, C. thiaminolyticum strain ATCC 15579, Enterococcus faecalis strain NCTC8176, Lactococcus lactis strain LM0230, Lactobacillus casei strain ATCC 344, Lactococcus lactis strain IL1403, L. jensenii strain ATCC 25258, Lactobacillus plantarum strain CECT220, L. brevis strain ATCC 8287, L. bulgaricus strain LMG13551, Pediococcus acidilactici strain ATCC 25740, P. pentosaceus strain ATCC 33316 and P. pentosaceus strain LMG13560 (+). Leuconostoc mesenteroides strain ATCC 19254, Lactococcus lactis strain ATCC 1454, L. sakei strain CECT906T, Lactococcus lactis subsp. cremoris strain MC1363 and L. curvatus strain ATCC 51436 (++).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP00073_predicted_structure.pdb to download.

DRAMP00073

• • Function

  • The mode of action appears to be non-lytic. Inactivated by proteinase K, but insensitive to trypsin, alpha-chymotrypsin, pepsin and papain.

• • Biophysicochemical properties

  • pH dependence (Remains active between pH 2 and 10); Temperature dependence (Remains active after incubation at 121 degrees Celsius for 1 hour).

• • PTM

  • Contains one disulfide bond 9-14.

• ·Literature 1

• • Title

  • Purification, amino acid sequence and characterization of the class IIa bacteriocin weissellin A, produced by Weissella paramesenteroides DX.

• • Pubmed ID

  • 21511463

• • Reference

  • Bioresour Technol. 2011 Jun;102(12):6730-6734.

• • Author

  • Papagianni M, Papamichael EM.