• • DRAMP ID

  • DRAMP00074

• • Peptide Name

  • Enterocin P (Pediocin-like peptide; Bacteriocin)

• • Source

  • Enterococcus faecium P13 (Gram-positive bacteria)

• • Family

  • Belongs to the class IIa bacteriocin

• • Gene

  • entP

• • Sequence

  • ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH

• • Sequence Length

  • 44

• • UniProt Entry

  • O30434,Q0GFE0

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • [Ref.9361419]Gram-positive bacteria: Pediococcus acidilactici (MIC=69 ng/ml), Pediococcus pentosaceus FBB61 (MIC=136 ng/ml), P. pntosaceus FBB63 (MIC=18 ng/ml), Lactococcus lactis BB24 (MIC=22 ng/ml), Enterococcus faecium (MIC=2 ng/ml), E. faecalis (MIC=238 ng/ml), Staphylococcus carnosus (MIC=139 ng/ml), Bacillus cereus (MIC=286 ng/ml), Clostridium sporogenes (MIC=4 ng/ml), Clostridium tyrobutyricum 3, 5CT (MIC=559 ng/ml), C. tyrobutyricum 1754 (MIC=412 ng/ml), Propionibacteruim sp P4 (MIC=37 ng/ml), Propionibacteruim sp P6 (MIC=26 ng/ml), Clostridium tyrobutyricum (MIC=4 ng/ml), Clostridium botulinum (MIC=259 ng/ml), Listeria monocytogenes 7973 (MIC=35 ng/ml), L. monocytogenes LI5sv1/2 (MIC=33 ng/ml), L. monocytogenes 5105 (MIC=18 ng/ml), L. monocytogenes L11sv4 (MIC=39 ng/ml), L. monocytogenes Scott A (MIC=125 ng/ml), Listeria innocua (MIC=395 ng/ml), Streptococcus aureus 137 (MIC=190 ng/ml), S. aureus 196E (MIC=407 ng/ml), S. aureus 349 (MIC=221 ng/ml), S. aureus 361 (MIC=294 ng/ml), S. aureus 472 (MIC=269 ng/ml), Lactobacillus curvatus (MIC=17 ng/ml), L. fermentum (MIC=1 ng/ml), L. sake (MIC=144 ng/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Bridge

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP00074_predicted_structure.pdb to download.

DRAMP00074

• • Function

  • Bacteriocin that inhibits the growth of wide range of Gram-positive bacterial species. Does not inhibit the growth of several strains of Gram-negative bacteria. No hemolytic activity against calf blood.

• • Biophysicochemical properties

  • pH dependence (Stable between pH 3.0 and pH 7.0); Temperature dependence (Thermostable, retains activity after heating at 100 and 121 degrees Celsius).

• • PTM

  • Contains one disulfide bond 11-16.

• ·Literature 1

• • Title

  • Biochemical and genetic characterization of enterocin P, a novel sec-dependent bacteriocin from Enterococcus faecium P13 with a broad antimicrobial spectrum.

• • Pubmed ID

  • 9361419

• • Reference

  • Appl Environ Microbiol. 1997 Nov;63(11):4321-4330.

• • Author

  • Cintas LM, Casaus P, H¥varstein LS, Hern¡ndez PE, Nes IF.

• ·Literature 2

• • Title

  • Single nucleotide polymorphism analysis of the enterocin P structural gene of Enterococcus faecium strains isolated from nonfermented animal foods.

• • Pubmed ID

  • 17103378

• • Reference

  • Mol Nutr Food Res. 2006 Dec;50(12):1229-1238.

• • Author

  • Arlindo S, Calo P, Franco C, Prado M, Cepeda A, Barros-Vel¡zquez J.