• DRAMP ID

    • DRAMP00074
    • Peptide Name

    • Enterocin P (Pediocin-like peptide; Bacteriocin)
    • Source

    • Enterococcus faecium P13 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • entP
    • Sequence

    • ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH
    • Sequence Length

    • 44
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-negative bacteria: Lactobacillus curvatus (MIC=17 ng/ml), L. fermentum (MIC=1 ng/ml), L. sake (MIC=144 ng/ml);
      • Gram-positive bacteria: Pediococcus acidilactici (MIC=69 ng/ml), Pediococcus pentosaceus FBB61 (MIC=136 ng/ml), P. pntosaceus FBB63 (MIC=18 ng/ml), Lactococcus lactis BB24 (MIC=22 ng/ml), Enterococcus faecium (MIC=2 ng/ml), E. faecalis (MIC=238 ng/ml), Staphylococcus carnosus (MIC=139 ng/ml), Bacillus cereus (MIC=286 ng/ml), Clostridium sporogenes (MIC=4 ng/ml), Clostridium tyrobutyricum 3, 5CT (MIC=559 ng/ml), C. tyrobutyricum 1754 (MIC=412 ng/ml), Propionibacteruim sp P4 (MIC=37 ng/ml), Propionibacteruim sp P6 (MIC=26 ng/ml), Clostridium tyrobutyricum (MIC=4 ng/ml), Clostridium botulinum (MIC=259 ng/ml), Listeria monocytogenes 7973 (MIC=35 ng/ml), L. monocytogenes LI5sv1/2 (MIC=33 ng/ml), L. monocytogenes 5105 (MIC=18 ng/ml), L. monocytogenes L11sv4 (MIC=39 ng/ml), L. monocytogenes Scott A (MIC=125 ng/ml), Listeria innocua (MIC=395 ng/ml), Streptococcus aureus 137 (MIC=190 ng/ml), S. aureus 196E (MIC=407 ng/ml), S. aureus 349 (MIC=221 ng/ml), S. aureus 361 (MIC=294 ng/ml), S. aureus 472 (MIC=269 ng/ml).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Formula

    • C202H303N59O61S3
    • Absent Amino Acids

    • DFPQ
    • Common Amino Acids

    • G
    • Mass

    • 5397.35
    • PI

    • 8.22
    • Basic Residues

    • 4
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Boman Index

    • -33.68
    • Hydrophobicity

    • -15
    • Aliphatic Index

    • 66.59
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19605
    • Absorbance 280nm

    • 455.93
    • Polar Residues

    • 22

DRAMP00074

DRAMP00074 chydropathy plot
    • Function

    • Bacteriocin that inhibits the growth of wide range of Gram-positive bacterial species. Does not inhibit the growth of several strains of Gram-negative bacteria.
    • Biophysicochemical properties

    • pH dependence (Stable between pH 3.0 and pH 7.0); Temperature dependence (Thermostable, retains activity after heating at 100 and 121 degrees Celsius).
    • PTM

    • Contains one disulfide bond 11-16.
  • Literature 1
    • Reference

    • Appl Environ Microbiol. 1997 Nov;63(11):4321-4330.
    • Author

    • Cintas LM, Casaus P, H¥varstein LS, Hern¡ndez PE, Nes IF.
    • Title

    • Biochemical and genetic characterization of enterocin P, a novel sec-dependent bacteriocin from Enterococcus faecium P13 with a broad antimicrobial spectrum.
  • Literature 2
    • Reference

    • Mol Nutr Food Res. 2006 Dec;50(12):1229-1238.
    • Author

    • Arlindo S, Calo P, Franco C, Prado M, Cepeda A, Barros-Vel¡zquez J.
    • Title

    • Single nucleotide polymorphism analysis of the enterocin P structural gene of Enterococcus faecium strains isolated from nonfermented animal foods.