• DRAMP ID

    • DRAMP00078
    • Peptide Name

    • Leucocin C (Leu C; Pediocin-like peptide; Bacteriocin)
    • Source

    • Leuconostoc mesenteroides (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • N/A
    • Sequence

    • KNYGNGVHCTKKGCSVDWGYAWTNIANNSVMNGLTGGNAGWHN
    • Sequence Length

    • 43
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • N/A
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP00078 helical wheel diagram
    • Formula

    • C198H291N61O61S3
    • Absent Amino Acids

    • EFPQR
    • Common Amino Acids

    • GN
    • Mass

    • 5347.39
    • PI

    • 8.77
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -55.79
    • Hydrophobicity

    • -66.51
    • Aliphatic Index

    • 45.35
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 19605
    • Absorbance 280nm

    • 466.79
    • Polar Residues

    • 25

DRAMP00078

DRAMP00078 chydropathy plot
    • Function

    • Inhibits a wide spectrum of lactic acid bacteria.
  • Literature 1
    • Title

    • The complete amino acid sequence of the pediocin-like antimicrobial peptide leucocin C.
    • Reference

    • Biochem Biophys Res Commun. 2002 Jul 26;295(4):826-827.
    • Author

    • Fimland G, Sletten K, Nissen-Meyer J.
  • Literature 2
    • Title

    • Sequence and structural relationships of leucocins A-, B- and C-TA33a from Leuconostoc mesenteroides TA33a.
    • Reference

    • Microbiology. 1998 May;144 (Pt 5):1343-1348.
    • Author

    • Papathanasopoulos MA, Dykes GA, Revol-Junelles AM, Delfour A, von Holy A, Hastings JW.