General Information

    • DRAMP ID

    • DRAMP00079

    • Peptide Name

    • Bacteriocin hiracin-JM79 (HirJM79; Bacteriocin)

    • Source

    • Enterococcus hirae DCH5 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • hirJM79

    • Sequence

    • ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Lactobacillus helveticus-
        Lactobacillus curvatus-
        Lactobacillus bulgaricus-
        Lactobacillus sakeii-
        Pediococcus pentosaceus-
        Enterococcus faecium-
        Enterococcus faecalis-
        Propionibacterium sp-
        Propionibacterium acidipropionici-
        Clostridium tyrobutiricum-
        Listeria monocytogenes-
        Listeria ivanovii-
        Listeria seeligeri-
        Listeria welshimeri-
        Listeria grayi-
        Staphylococcus aureus-
        Staphylococcus aureus-

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00079 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00079.

Physicochemical Information

    • Formula

    • C232H340N66O61S2

    • Absent Amino Acids

    • FMS

    • Common Amino Acids

    • G

    • Mass

    • 5093.78

    • PI

    • 9.15

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -66.02

    • Hydrophobicity

    • -0.746

    • Aliphatic Index

    • 62.05

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 26595

    • Absorbance 280nm

    • 618.49

    • Polar Residues

    • 17

DRAMP00079

DRAMP00079 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity. Lacks antibacterial activity against Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Amino acid and nucleotide sequence, adjacent genes, and heterologous expression of hiracin JM79, a sec-dependent bacteriocin produced by Enterococcus hirae DCH5, isolated from Mallard ducks (Anas platyrhynchos).

    • Reference

    • FEMS Microbiol Lett. 2007 May;270(2):227-236.

    • Author

    • S¡nchez J, Diep DB, Herranz C, Nes IF, Cintas LM, Hern¡ndez PE.