• DRAMP ID

    • DRAMP00079
    • Peptide Name

    • Bacteriocin hiracin-JM79 (HirJM79; Bacteriocin)
    • Source

    • Enterococcus hirae DCH5 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • hirJM79
    • Sequence

    • ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR
    • Sequence Length

    • 44
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria: Lactobacillus helveticus, Lactobacillus curvatus, Lactobacillus bulgaricus, Lactobacillus sakeii, Pediococcus pentosaceus, Enterococcus faecium, Enterococcus faecalis, Propionibacterium sp, Propionibacterium acidipropionici, Clostridium tyrobutiricum, Listeria monocytogenes, Listeria ivanovii, Listeria seeligeri, Listeria welshimeri, Listeria grayi, Staphylococcus aureus, Staphylococcus aureus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00079 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C232H340N66O61S2
    • Absent Amino Acids

    • FMS
    • Common Amino Acids

    • G
    • Mass

    • 5093.78
    • PI

    • 9.15
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +4
    • Boman Index

    • -66.02
    • Hydrophobicity

    • -0.746
    • Aliphatic Index

    • 62.05
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 26595
    • Absorbance 280nm

    • 618.49
    • Polar Residues

    • 17

DRAMP00079

DRAMP00079 chydropathy plot
    • Function

    • Has antibacterial activity. Lacks antibacterial activity against Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Amino acid and nucleotide sequence, adjacent genes, and heterologous expression of hiracin JM79, a sec-dependent bacteriocin produced by Enterococcus hirae DCH5, isolated from Mallard ducks (Anas platyrhynchos).
    • Reference

    • FEMS Microbiol Lett. 2007 May;270(2):227-236.
    • Author

    • S¡nchez J, Diep DB, Herranz C, Nes IF, Cintas LM, Hern¡ndez PE.