• DRAMP ID

    • DRAMP00080
    • Peptide Name

    • Curvacin A (Bacteriocin)
    • Source

    • Lactobacillus curvatus LTH1174 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • curA
    • Sequence

    • ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM
    • Sequence Length

    • 41
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Closely related Lactobacilli-
        Listeria monocytogenes and ivanovvi-
        Enterococcus faecalis-
        Carnobacterium sp and Brocothrix thermosphacta-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix (2 helices; 17 residues)
    • Structure Description

    • In DPC micelles, the cationic and hydrophilic N-terminal half of the peptide forms an S-shaped beta-sheet-like domain stabilized by a disulfide bridge and a few hydrogen bonds. This domain is followed by a helix-hinge-helix motif: a hydrophilic 6-mer helix (residues 19-24) and an amphiphilic/hydrophobic 11-mer helix (residues 29-39).
    • Helical Wheel Diagram

    • DRAMP00080 helical wheel diagram
    • PDB ID

    • 2A2B resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP00080.
    • Formula

    • C184H288N56O56S4
    • Absent Amino Acids

    • DFHP
    • Common Amino Acids

    • G
    • Mass

    • 4308.89
    • PI

    • 9.31
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +3
    • Boman Index

    • -41.86
    • Hydrophobicity

    • -0.185
    • Aliphatic Index

    • 61.95
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14105
    • Absorbance 280nm

    • 352.63
    • Polar Residues

    • 21

DRAMP00080

DRAMP00080 chydropathy plot
    • PTM

    • Contains one disulfide bond 10-15.
  • ·Literature 1
    • Title

    • Cloning and sequencing of curA encoding curvacin A, the bacteriocin produced by Lactobacillus curvatus LTH1174.
    • Reference

    • Arch Microbiol. 1993;160(4):279-283.
    • Author

    • Tichaczek PS, Vogel RF, Hammes WP.
  • ·Literature 2
    • Title

    • Three-dimensional structure in lipid micelles of the pediocin-like antimicrobial peptide curvacin A.
    • Reference

    • Biochemistry. 2005 Dec 13;44(49):16149-16157.
    • Author

    • Haugen HS, Fimland G, Nissen-Meyer J, Kristiansen PE.