General Information

    • DRAMP ID

    • DRAMP00080

    • Peptide Name

    • Curvacin A (Bacteriocin)

    • Source

    • Lactobacillus curvatus LTH1174 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • curA

    • Sequence

    • ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM

    • Sequence Length

    • 41

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Closely related Lactobacilli, Listeria monocytogenes and ivanovvi, Enterococcus faecalis, Carnobacterium sp and Brocothrix thermosphacta.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (2 helices; 17 residues)

    • Structure Description

    • In DPC micelles, the cationic and hydrophilic N-terminal half of the peptide forms an S-shaped beta-sheet-like domain stabilized by a disulfide bridge and a few hydrogen bonds. This domain is followed by a helix-hinge-helix motif: a hydrophilic 6-mer helix (residues 19-24) and an amphiphilic/hydrophobic 11-mer helix (residues 29-39).

    • Helical Wheel Diagram

    • DRAMP00080 helical wheel diagram

    • PDB ID

    • 2A2B resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00080.

Physicochemical Information

    • Formula

    • C184H288N56O56S4

    • Absent Amino Acids

    • DFHP

    • Common Amino Acids

    • G

    • Mass

    • 4308.89

    • PI

    • 9.31

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -41.86

    • Hydrophobicity

    • -0.185

    • Aliphatic Index

    • 61.95

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14105

    • Absorbance 280nm

    • 352.63

    • Polar Residues

    • 21

DRAMP00080

DRAMP00080 chydropathy plot

Comments Information

    • PTM

    • Contains one disulfide bond 10-15.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and sequencing of curA encoding curvacin A, the bacteriocin produced by Lactobacillus curvatus LTH1174.

    • Reference

    • Arch Microbiol. 1993;160(4):279-283.

    • Author

    • Tichaczek PS, Vogel RF, Hammes WP.
  • ·Literature 2

    • Title

    • Three-dimensional structure in lipid micelles of the pediocin-like antimicrobial peptide curvacin A.

    • Reference

    • Biochemistry. 2005 Dec 13;44(49):16149-16157.

    • Author

    • Haugen HS, Fimland G, Nissen-Meyer J, Kristiansen PE.