General Information

    • DRAMP ID

    • DRAMP00081

    • Peptide Name

    • Leucocin-A (Leucocin A-UAL 187; Leu A; Bacteriocin)

    • Source

    • Leuconostoc gelidum (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • lcnA

    • Sequence

    • KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Lactic acid bacteria, Listeria monocytogenes.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • In both TFE and DPC micelle, The region encompassing residues 17-31 assumes an essentially identical amphiphilic alpha-helix conformation. A three-strand antiparallel beta-sheet domain (residues 2-16), anchored by the disulfide bridge. In TFE, these two regions have a more defined relationship relative to each other, while, in DPC micelles, the C-terminus is folded back onto the alpha-helix.

    • Helical Wheel Diagram

    • DRAMP00081 helical wheel diagram

    • PDB ID

    • 1CW6 resolved by NMR.
  • 1CW6-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00081.

Physicochemical Information

    • Formula

    • C174H248N52O50S2

    • Absent Amino Acids

    • DIMPQ

    • Common Amino Acids

    • G

    • Mass

    • 3932.32

    • PI

    • 8.82

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -38.59

    • Hydrophobicity

    • -0.392

    • Aliphatic Index

    • 42.16

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14105

    • Absorbance 280nm

    • 391.81

    • Polar Residues

    • 20

DRAMP00081

DRAMP00081 chydropathy plot

Comments Information

    • Function

    • Inhibits a wide spectrum of lactic acid bacteria.

    • PTM

    • Contains one disulfide bond 9-14.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of leucocin A-UAL 187 and cloning of the bacteriocin gene from Leuconostoc gelidum.

    • Reference

    • J Bacteriol. 1991 Dec;173(23):7491-7500.

    • Author

    • Hastings JW, Sailer M, Johnson K, Roy KL, Vederas JC, Stiles ME.
  • ·Literature 2

    • Title

    • 15N- and 13C-labeled media from Anabaena sp. for universal isotopic labeling of bacteriocins: NMR resonance assignments of leucocin A from Leuconostoc gelidum and nisin A from Lactococcus lactis.

    • Reference

    • Biochemistry. 1993 Jan 12;32(1):310-318.

    • Author

    • Sailer M, Helms GL, Henkel T, Niemczura WP, Stiles ME, Vederas JC.
  • ·Literature 3

    • Title

    • Three-dimensional structure of leucocin A in trifluoroethanol and dodecylphosphocholine micelles: spatial location of residues critical for biological activity in type IIa bacteriocins from lactic acid

    • Reference

    • Biochemistry. 1997 Dec 9;36(49):15062-15072.

    • Author