General Information

    • DRAMP ID

    • DRAMP00082

    • Peptide Name

    • Bavaricin-MN (Bacteriocin)

    • Source

    • Lactobacillus sakeii (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • TKYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGGAIPGK

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Listeria monocytogenes Scott A.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00082 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C195H288N52O53S2

    • Absent Amino Acids

    • EFHMR

    • Common Amino Acids

    • G

    • Mass

    • 4402.21

    • PI

    • 9.14

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +3

    • Boman Index

    • -8.94

    • Hydrophobicity

    • -0.179

    • Aliphatic Index

    • 62.62

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 21095

    • Absorbance 280nm

    • 514.51

    • Polar Residues

    • 20

DRAMP00082

DRAMP00082 chydropathy plot

Comments Information

    • PTM

    • contains one disulfide bond 10-15.

Literature Information

  • ·Literature 1

    • Title

    • Purification of the bacteriocin bavaricin MN and characterization of its mode of action against Listeria monocytogenes Scott A cells and lipid vesicles.

    • Reference

    • Appl Environ Microbiol. 1996 Dec;62(12):4529-4535.

    • Author

    • Kaiser AL, Montville TJ.