• DRAMP ID

    • DRAMP00082
    • Peptide Name

    • Bavaricin-MN (Bacteriocin)
    • Source

    • Lactobacillus sakeii (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Unknown
    • Sequence

    • TKYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGGAIPGK
    • Sequence Length

    • 42
    • Evidence code

    • Protein level
    • Biological Activity

    • Antimicrobial, Anti-Gram+
    • Target Organism

      • Gram-positive bacterium: Listeria monocytogenes Scott A.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Formula

    • C195H288N52O53S2
    • Absent Amino Acids

    • EFHMR
    • Common Amino Acids

    • G
    • Mass

    • 5114.39
    • PI

    • 9.25
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 13
    • Boman Index

    • -8.94
    • Hydrophobicity

    • -17.86
    • Aliphatic Index

    • 62.62
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 21095
    • Absorbance 280nm

    • 514.51
    • Polar Residues

    • 20

DRAMP00082

DRAMP00082 chydropathy plot
    • PTM

    • contains one disulfide bond 10-15.
  • Literature 1
    • Reference

    • Appl Environ Microbiol. 1996 Dec;62(12):4529-4535.
    • Author

    • Kaiser AL, Montville TJ.
    • Title

    • Purification of the bacteriocin bavaricin MN and characterization of its mode of action against Listeria monocytogenes Scott A cells and lipid vesicles.