• DRAMP ID

    • DRAMP00085
    • Peptide Name

    • Bacteriocin
    • Source

    • Lactococcus sp
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Not found
    • Sequence

    • TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILWSLKE
    • Sequence Length

    • 41
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Streptococcus aureus-
        Bacillus thuringiensis;-
      • Gram-negative bacteria:
        Target OrganismActivity
        Salmonella typhi-
        Klebsiella sp.-
        Escherichia coli KL16 and Escherichia coli Gj137-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00085 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00085.
    • Formula

    • C203H315N53O65S2
    • Absent Amino Acids

    • FMQR
    • Common Amino Acids

    • KS
    • Mass

    • 4602.17
    • PI

    • 6.44
    • Basic Residues

    • 6
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +1
    • Boman Index

    • -66.62
    • Hydrophobicity

    • -0.59
    • Aliphatic Index

    • 71.22
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14105
    • Absorbance 280nm

    • 352.63
    • Polar Residues

    • 18

DRAMP00085

DRAMP00085 chydropathy plot
    • Function

    • Has bacteriocin active.
  • ·Literature 1
    • Title

    • Molecular characterisation of bacteriocin from microflora associated with radish and ginger.
    • Reference

    • Submitted (APR-2009) to UniProtKB
    • Author

    • Ingale A.G.