• DRAMP ID

    • DRAMP00085
    • Peptide Name

    • Bacteriocin
    • Source

    • Lactococcus sp
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Unknown
    • Sequence

    • TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILWSLKE
    • Sequence Length

    • 41
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Streptococcus aureus, Bacillus thuringiensis;
      • Gram-negative bacteria: Salmonella typhi, Klebsiella sp., Escherichia coli KL16 and Escherichia coli Gj137.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00085 helical wheel diagram
    • Formula

    • C203H315N53O65S2
    • Absent Amino Acids

    • FMQR
    • Common Amino Acids

    • KS
    • Mass

    • 5315.82
    • PI

    • 7.25
    • Basic Residues

    • 6
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -66.62
    • Hydrophobicity

    • -59.02
    • Aliphatic Index

    • 71.22
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14105
    • Absorbance 280nm

    • 352.63
    • Polar Residues

    • 18

DRAMP00085

DRAMP00085 chydropathy plot
    • Function

    • Has bacteriocin active.
  • Literature 1
    • Reference

    • Submitted (APR-2009) to UniProtKB
    • Author

    • Ingale A.G.
    • Title

    • Molecular characterisation of bacteriocin from microflora associated with radish and ginger.