• • DRAMP ID

  • DRAMP00085

• • Peptide Name

  • Bacteriocin

• • Source

  • Lactococcus sp

• • Family

  • Belongs to the class IIa bacteriocin

• • Gene

  • Not found

• • Sequence

  • TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILWSLKE

• • Sequence Length

  • 41

• • UniProt Entry

  • P86291

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-positive bacteria: Streptococcus aureus, Bacillus thuringiensis;
    • Gram-negative bacteria: Salmonella typhi, Klebsiella sp., Escherichia coli KL16 and Escherichia coli Gj137.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00085.

DRAMP00085

• • Function

  • Has bacteriocin active.

• ·Literature 1

• • Title

  • Molecular characterisation of bacteriocin from microflora associated with radish and ginger.

• • Pubmed ID

  • PubMed ID is not available

• • Reference

  • Submitted (APR-2009) to UniProtKB

• • Author

  • Ingale A.G.