• DRAMP ID

    • DRAMP00086
    • Peptide Name

    • Divergicin M35 (Pediocin-like peptide; Bacteriocin)
    • Source

    • Carnobacterium divergens M35 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Unknown
    • Sequence

    • TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC
    • Sequence Length

    • 43
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Anti-Gram+, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Many strains of Listeria monocytogenes, L. seeligeri, L. welshimeri, L. grayi, L. murayi, L. ivanovii, L. innocus, Ceanothus divergens and Carnobacterium piscicola.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Formula

    • C200H308N54O58S4
    • Absent Amino Acids

    • EFHMR
    • Common Amino Acids

    • G
    • Mass

    • 5274.58
    • PI

    • 8.65
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -21.68
    • Hydrophobicity

    • -18.84
    • Aliphatic Index

    • 65.58
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 15720
    • Absorbance 280nm

    • 374.29
    • Polar Residues

    • 22

DRAMP00086

DRAMP00086 chydropathy plot
    • Function

    • Bacteriocin with antibacterial activity against Gram-positive bacteria.
    • Biophysicochemical properties

    • Displays a high degree of stability when incubated at temperatures of up to 121 degrees Celsius for 60 minutes.
    • Biotechnological use

    • Has potential for use as a biopreservative for inhibiting Listeria monocytogenes in seafood products that do not usually undergo an adequate heat treatment.
  • Literature 1
    • Reference

    • Int J Food Microbiol. 2004 Dec 15;97(2):123-136.
    • Author

    • Tahiri I, Desbiens M, Benech R, Kheadr E, Lacroix C, Thibault S, Ouellet D, Fliss I.
    • Title

    • Purification, characterization and amino acid sequencing of divergicin M35: a novel class IIa bacteriocin produced by Carnobacterium divergens M35.