General Information

    • DRAMP ID

    • DRAMP00086

    • Peptide Name

    • Divergicin M35 (Pediocin-like peptide; Bacteriocin)

    • Source

    • Carnobacterium divergens M35 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Many strains of Listeria monocytogenes, L. seeligeri, L. welshimeri, L. grayi, L. murayi, L. ivanovii, L. innocus, Ceanothus divergens and Carnobacterium piscicola.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00086 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C200H308N54O58S4

    • Absent Amino Acids

    • EFHMR

    • Common Amino Acids

    • G

    • Mass

    • 4525.21

    • PI

    • 8.8

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -21.68

    • Hydrophobicity

    • -0.188

    • Aliphatic Index

    • 65.58

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 15720

    • Absorbance 280nm

    • 374.29

    • Polar Residues

    • 22

DRAMP00086

DRAMP00086 chydropathy plot

Comments Information

    • Function

    • Bacteriocin with antibacterial activity against Gram-positive bacteria.

    • Biophysicochemical properties

    • Displays a high degree of stability when incubated at temperatures of up to 121 degrees Celsius for 60 minutes.

    • Biotechnological use

    • Has potential for use as a biopreservative for inhibiting Listeria monocytogenes in seafood products that do not usually undergo an adequate heat treatment.

Literature Information

  • ·Literature 1

    • Title

    • Purification, characterization and amino acid sequencing of divergicin M35: a novel class IIa bacteriocin produced by Carnobacterium divergens M35.

    • Reference

    • Int J Food Microbiol. 2004 Dec 15;97(2):123-136.

    • Author

    • Tahiri I, Desbiens M, Benech R, Kheadr E, Lacroix C, Thibault S, Ouellet D, Fliss I.