• DRAMP ID

    • DRAMP00089
    • Peptide Name

    • Bacteriocin E50-52 (Preclinical)
    • Source

    • Enterococcus faecium (Streptococcus faecium) (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Unknow
    • Sequence

    • TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA
    • Sequence Length

    • 39
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-negative bacteria: Campylobacter jejuni (MIC=0.025-6.4 µg/ml), Yersinia enterocolitica, Yersinia pseudotuberculosis, Escherichia coli O157:H7 (MIC<1.6 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (MIC=0.2-0.8 µg/ml), Staphylococcus epidermidis (MIC=0.2-0.8 µg/ml), Listeria monocytogenes (MIC=2-8 µg/ml), Listeria grayi, Listeria innocua, Listeria ivanovii, Listeria denitrificans (MIC=32 µg/ml), Morganella morganii, Salmonella spp., Shigella dysenteriae.
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00089 helical wheel diagram
    • Formula

    • C175H267N51O53S6
    • Absent Amino Acids

    • DEFHIMPR
    • Common Amino Acids

    • CN
    • Mass

    • 4803.74
    • PI

    • 8.11
    • Basic Residues

    • 2
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 14
    • Boman Index

    • -16.77
    • Hydrophobicity

    • 16.41
    • Aliphatic Index

    • 65.13
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18365
    • Absorbance 280nm

    • 483.29
    • Polar Residues

    • 22

DRAMP00089

DRAMP00089 chydropathy plot
    • Function

    • Bacteriocin active against the Gram-negative bacteria and the Gram-positive bacteria. When added to the drinking water of chickens, causes a decrease in the levels of Campylobacter jejuni and S. enteritidis in the ceca, and in the levels of S.enteritidis in the liver and spleen.
  • Literature 1
    • Reference

    • J Agric Food Chem. 2008 Mar 26;56(6):1942-1948.
    • Author

    • Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Borzenkov VN, Levchuk VP, Svetoch OE, Kovalev YN, Stepanshin YG, Siragusa GR, Seal BS, Stern NJ.
    • Title

    • Diverse antimicrobial killing by Enterococcus faecium E 50-52 bacteriocin.