• DRAMP ID

    • DRAMP00090
    • Peptide Name

    • Carnobacteriocin B2 (CbnB2; Bacteriocin)
    • Source

    • Carnobacterium piscicola LV18B (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • cbnB2
    • Sequence

    • VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP
    • Sequence Length

    • 48
    • Evidence code

    • Protein level
    • Biological Activity

    • Antilisterial
    • Target Organism

      • Gram-negative bacteria: Lactobacillus plantarum ATCC 4008 (MIC=2 ug/ml), Pediococcus parvulus ATCC 19371 (MIC=8 ug/ml), Listeria monocytogenes ATCC 15313 (MIC=32 ug/ml), Listeria innocua ATCC 33090 (MIC=16 ug/ml), Enterococcus faecium ATCC 11576 (MIC=16 ug/ml), Enterococcus faecalis ATCC 19433 (MIC=16 ug/ml), E. faecium ATCC 19434 (MIC=4 ug/ml).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Alpha helix (1 helices; 24 residues)
    • Structure Description

    • CbnB2 forms a disulfide bond and that this peptide has full antimicrobial activity. NMR results indicate that CbnB2 in TFE has a well-defined central helical structure (residues 18-39) but a disordered N terminus. And the central helical structure is conserved.
    • PDB ID

    • 1CW5 resolved by NMR.
    • DRAMP00090 helical wheel diagram
    • 1CW5-> 
    • Formula

    • C213H332N66O68S2
    • Absent Amino Acids

    • DHLM
    • Common Amino Acids

    • G
    • Mass

    • 5807.99
    • PI

    • 9.96
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 14
    • Boman Index

    • -73.88
    • Hydrophobicity

    • -27.71
    • Aliphatic Index

    • 54.79
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 183.09
    • Polar Residues

    • 25

Amino Acid Distribution

DRAMP00090 chydropathy plot
    • Function

    • Has antibacterial activity against Listeria and Enterococcus.
    • PTM

    • Contains one disulfide bond 9-14.
  • Literature 1
    • Reference

    • J Biol Chem 1994; 269: 12204-12211.
    • Author

    • Quadri LE et al Stiles ME.
    • Title

    • Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV18B.
  • Literature 2
    • Reference

    • Curr Microbiol. 1997 Dec;35(6):319-326.
    • Author

    • Herbin S, Mathieu F, BrulĀ© F, Branlant C, Lefebvre G, Lebrihi A.
    • Title

    • Characteristics and genetic determinants of bacteriocin activities produced by Carnobacterium piscicola CP5 isolated from cheese.
  • Literature 3
    • Reference

    • Biochemistry. 1999 Nov 23;38(47):15438-15447.
    • Author

    • Wang Y, Henz ME, Gallagher NL, Chai S, Gibbs AC, Yan LZ, Stiles ME, Wishart DS, Vederas JC.
    • Title

    • Solution structure of carnobacteriocin B2 and implications for structure-activity relationships among type IIa bacteriocins from lactic acid bacteria.