• DRAMP ID

    • DRAMP00090
    • Peptide Name

    • Carnobacteriocin B2 (CbnB2; Bacteriocin)
    • Source

    • Carnobacterium piscicola LV18B (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • cbnB2
    • Sequence

    • VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP
    • Sequence Length

    • 48
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • [Ref.8163526]Gram-positive bacteria: Lactobacillus plantarum ATCC 4008 (MIC=2 AU/μg), Pediococcus parvulus ATCC 19371 (MIC=8 AU/μg), Listeria monocytogenes ATCC 15313 (MIC=32 AU/μg), Listeria innocua ATCC 33090 (MIC=16 AU/μg), Enterococcus faecium ATCC 11576 (MIC=16 AU/μg), Enterococcus faecalis ATCC 19433 (MIC=16 AU/μg), Enterococcus faecium ATCC 19434 (MIC=4 AU/μg).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • [Ref.8163526 & Ref.10569926] CbnB2 can easily form a disulfide bond between Cys9 and Cys14
    • Stereochemistry

    • L
    • Structure

    • Alpha helix (1 helices; 24 residues)
    • Structure Description

    • CbnB2 forms a disulfide bond and that this peptide has full antimicrobial activity. NMR results indicate that CbnB2 in TFE has a well-defined central helical structure (residues 18-39) but a disordered N terminus. And the central helical structure is conserved.
    • Helical Wheel Diagram

    • DRAMP00090 helical wheel diagram
    • PDB ID

    • 1CW5 resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP00090.
    • Formula

    • C213H332N66O68S2
    • Absent Amino Acids

    • DHLM
    • Common Amino Acids

    • G
    • Mass

    • 4969.5
    • PI

    • 9.7
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +4
    • Boman Index

    • -73.88
    • Hydrophobicity

    • -0.277
    • Aliphatic Index

    • 54.79
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 183.09
    • Polar Residues

    • 25

DRAMP00090

DRAMP00090 chydropathy plot
    • Function

    • Has antibacterial activity against Listeria and Enterococcus.
    • PTM

    • Contains one disulfide bond 9-14.
  • ·Literature 1
    • Title

    • Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV18B.
    • Reference

    • J Biol Chem 1994; 269: 12204-12211.
    • Author

    • Quadri LE et al Stiles ME.
  • ·Literature 2
    • Title

    • Characteristics and genetic determinants of bacteriocin activities produced by Carnobacterium piscicola CP5 isolated from cheese.
    • Reference

    • Curr Microbiol. 1997 Dec;35(6):319-326.
    • Author

    • Herbin S, Mathieu F, Brul© F, Branlant C, Lefebvre G, Lebrihi A.
  • ·Literature 3
    • Title

    • Solution structure of carnobacteriocin B2 and implications for structure-activity relationships among type IIa bacteriocins from lactic acid bacteria.
    • Reference

    • Biochemistry. 1999 Nov 23;38(47):15438-15447.
    • Author

    • Wang Y, Henz ME, Gallagher NL, Chai S, Gibbs AC, Yan LZ, Stiles ME, Wishart DS, Vederas JC.