• DRAMP ID

    • DRAMP00091
    • Peptide Name

    • Carnobacteriocin BM1 (Carnobacteriocin B1; Bacteriocin)
    • Source

    • Carnobacterium piscicola LV17B (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • cbnBM1
    • Sequence

    • AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH
    • Sequence Length

    • 43
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • Listeria and Enterococcus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00091 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00091.
    • Formula

    • C199H310N56O59S3
    • Absent Amino Acids

    • DFPR
    • Common Amino Acids

    • G
    • Mass

    • 4527.17
    • PI

    • 8.76
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +3
    • Boman Index

    • -23.71
    • Hydrophobicity

    • -0.077
    • Aliphatic Index

    • 77.21
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14105
    • Absorbance 280nm

    • 335.83
    • Polar Residues

    • 19

DRAMP00091

DRAMP00091 chydropathy plot
    • Function

    • Has antibacterial activity.
    • PTM

    • Probablely contains one disulfide bond 10-15.
  • ·Literature 1
    • Title

    • Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV17B
    • Reference

    • J Biol Chem 1994; 269: 12204-12211.
    • Author

    • Quadri LE et al Stiles ME