General Information

    • DRAMP ID

    • DRAMP00091

    • Peptide Name

    • Carnobacteriocin BM1 (Carnobacteriocin B1; Bacteriocin)

    • Source

    • Carnobacterium piscicola LV17B (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • cbnBM1

    • Sequence

    • AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Listeria and Enterococcus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00091 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C199H310N56O59S3

    • Absent Amino Acids

    • DFPR

    • Common Amino Acids

    • G

    • Mass

    • 4527.17

    • PI

    • 8.76

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +3

    • Boman Index

    • -23.71

    • Hydrophobicity

    • -0.077

    • Aliphatic Index

    • 77.21

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14105

    • Absorbance 280nm

    • 335.83

    • Polar Residues

    • 19

DRAMP00091

DRAMP00091 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Probablely contains one disulfide bond 10-15.

Literature Information

  • ·Literature 1

    • Title

    • Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV17B

    • Reference

    • J Biol Chem 1994; 269: 12204-12211.

    • Author

    • Quadri LE et al Stiles ME