General Information

    • DRAMP ID

    • DRAMP00092

    • Peptide Name

    • Bacteriocin SRCAM 602 (Preclinical)

    • Source

    • Paenibacillus polymyxa (Bacillus polymyxa) (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • ATYYGNGLYCNKQKHYTWVDWNKASREIGKIIVNGWVQH

    • Sequence Length

    • 39

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Clostridium jejuni.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00092 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00092.

Physicochemical Information

    • Formula

    • C213H311N59O57S

    • Absent Amino Acids

    • FMP

    • Common Amino Acids

    • GKNY

    • Mass

    • 4642.23

    • PI

    • 9.31

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -61.26

    • Hydrophobicity

    • -0.774

    • Aliphatic Index

    • 67.44

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 22460

    • Absorbance 280nm

    • 591.05

    • Polar Residues

    • 16

DRAMP00092

DRAMP00092 chydropathy plot

Comments Information

    • Function

    • Bacteriocin with antibacterial activity.

    • Miscellaneous

    • Antimicrobial activity is lost upon treatment with beta-chymotrypsin, proteinase K and papain, but not when treated with lysozyme or lipase.

    • Biophysicochemical properties

    • pH dependence (Stable from pH 3.0-9.0, inactivated at pH 10.0); Temperature dependence (Thermostable, activity is retained after incubation at 100 degrees Celsius for 15 minutes).

Literature Information

  • ·Literature 1

    • Title

    • Isolation of Bacillus circulans and Paenibacillus polymyxa strains inhibitory to Campylobacter jejuni and characterization of associated bacteriocins.

    • Reference

    • J Food Prot. 2005 Jan;68(1):11-17.

    • Author

    • Svetoch EA, Stern NJ, Eruslanov BV, Kovalev YN, Volodina LI, Perelygin VV, Mitsevich EV, Mitsevich IP, Pokhilenko VD, Borzenkov VN, Levchuk VP, Svetoch OE, Kudriavtseva TY.