• DRAMP ID

    • DRAMP00092
    • Peptide Name

    • Bacteriocin SRCAM 602 (Preclinical)
    • Source

    • Paenibacillus polymyxa (Bacillus polymyxa) (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Not found
    • Sequence

    • ATYYGNGLYCNKQKHYTWVDWNKASREIGKIIVNGWVQH
    • Sequence Length

    • 39
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Clostridium jejuni-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00092 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00092.
    • Formula

    • C213H311N59O57S
    • Absent Amino Acids

    • FMP
    • Common Amino Acids

    • GKNY
    • Mass

    • 4642.23
    • PI

    • 9.31
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +5
    • Boman Index

    • -61.26
    • Hydrophobicity

    • -0.774
    • Aliphatic Index

    • 67.44
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 22460
    • Absorbance 280nm

    • 591.05
    • Polar Residues

    • 16

DRAMP00092

DRAMP00092 chydropathy plot
    • Function

    • Bacteriocin with antibacterial activity.
    • Miscellaneous

    • Antimicrobial activity is lost upon treatment with beta-chymotrypsin, proteinase K and papain, but not when treated with lysozyme or lipase.
    • Biophysicochemical properties

    • pH dependence (Stable from pH 3.0-9.0, inactivated at pH 10.0); Temperature dependence (Thermostable, activity is retained after incubation at 100 degrees Celsius for 15 minutes).
  • ·Literature 1
    • Title

    • Isolation of Bacillus circulans and Paenibacillus polymyxa strains inhibitory to Campylobacter jejuni and characterization of associated bacteriocins.
    • Reference

    • J Food Prot. 2005 Jan;68(1):11-17.
    • Author

    • Svetoch EA, Stern NJ, Eruslanov BV, Kovalev YN, Volodina LI, Perelygin VV, Mitsevich EV, Mitsevich IP, Pokhilenko VD, Borzenkov VN, Levchuk VP, Svetoch OE, Kudriavtseva TY.